ID Q9VTL1; PN PCI domain-containing protein 2 homolog; GN PCID2; OS 7227; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Nucleus {ECO:0000269|PubMed:18086857, ECO:0000269|PubMed:27016737}. Cytoplasm {ECO:0000269|PubMed:18086857, ECO:0000269|PubMed:33602059}. Nucleus membrane {ECO:0000269|PubMed:33602059}. Cytoplasm, cytoskeleton {ECO:0000269|PubMed:33602059}. Note=Shuttles in and out of the nucleus by a emb/Crm1-dependent mechanism (PubMed:18086857). The ubiquitinated forms are localized to the cytoplasm, the nonubiquitinated forms are localized to the nucleus, and both forms are associated with the nuclear membrane (PubMed:33602059). Associated with cytoplasmic microtubules (PubMed:33602059). Associates with mRNA in the nucleus and cytoplasm (PubMed:33602059). {ECO:0000269|PubMed:18086857, ECO:0000269|PubMed:33602059}. DR UNIPROT: Q9VTL1; DR Pfam: PF01399; DR PROSITE: PS50250; DE Function: Required for the export of nuclear mRNAs and involved in mRNA trafficking in the cytoplasm (PubMed:27016737, PubMed:28554770, PubMed:33602059). Component of the nuclear pore complex (NPC)- associated TREX-2/AMEX complex (anchoring and mRNA export complex) which functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket), thereby enabling the export of mRNAs to the cytoplasm through the nuclear pores (PubMed:27016737, PubMed:28554770, PubMed:33602059). Within the complex, specifically promotes the association of factors involved in regulating nuclear mRNA export, such as Moe, sbr/NXF1 and the ORC complex, to the mRNPs particles (PubMed:27016737, PubMed:28554770, PubMed:33602059). In the cytoplasm, functions independently of its role in the TREX-2/AMEX complex, to promote cytoplasmic mRNA trafficking together with nudC (PubMed:33602059). Associates with translationally active polysomes (PubMed:18086857). {ECO:0000269|PubMed:18086857, ECO:0000269|PubMed:27016737, ECO:0000269|PubMed:28554770, ECO:0000269|PubMed:33602059}. DE Reference Proteome: Yes; DE Interaction: Q9VM46; IntAct: EBI-15146793; Score: 0.62 DE Interaction: O18388; IntAct: EBI-258749; Score: 0.00 GO GO:0005737; GO GO:0005856; GO GO:0031965; GO GO:0005634; GO GO:0005844; GO GO:0070390; GO GO:0003690; GO GO:0019904; GO GO:0003723; GO GO:0006406; GO GO:0016973; GO GO:0000973; GO GO:0015031; GO GO:0006417; GO GO:0006368; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MFGTVNNYLSGVLHAAQDLDGESLATYLSLRDVHVQNHNLYIAQPEKLVDRFLKPPLDEVVSAHLKVLYHLAQEPPGYME SQ AYTQQSAACGAVVRLLQQLKDENWCLPLMYRVCLDLRYLAQACEKHCQGFTPGHVLEKAADCIMACFRVCAADGRASEED SQ TKRLGMMNLVNQLFKIYFRINKLHLCKPLIRAIDNCIFKDSFPLPEQITYKYFVGRRAMFDSNYQAAVQYLSYAFSNCPD SQ RFASNKRLILIYLVPVKMLLGYLPSKSLLQRYDLLLFLDLAMAMKAGNVNRFDEIVRDQELVLIRSGIYLLVEKLKFLVY SQ RNLFKKVFVIRKSHQLDMGDFLSALHFVGLTDVSLDETHCIVANLIYDGKIKGYISHAHNKLVVSKQNPFPSVSL //