ID  Q9VVA8;
PN  Transmembrane protein 258;
GN  kud;
OS  7227;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0182;
SL  Nucleus Position: SL-0183;
SL  Comments: Nucleus outer membrane {ECO:0000269|PubMed:28716842}; Multi-pass membrane protein {ECO:0000305}. Cytoplasm {ECO:0000269|PubMed:28716842}. Endoplasmic reticulum membrane {ECO:0000269|PubMed:28716842}.
DR  UNIPROT: Q9VVA8;
DR  Pfam: PF05251;
DE  Function: Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol- pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity (By similarity). In addition may regulates nuclear envelope (NE) architecture and nuclear positioning through the linker of nucleoskeleton and cytoskeleton (LINC)-dependent and -independent mechanisms (PubMed:28716842). {ECO:0000250|UniProtKB:P61165, ECO:0000269|PubMed:28716842}.
DE  Reference Proteome: Yes;
DE  Interaction: Q9W0Q4; IntAct: EBI-248309; Score: 0.00
GO  GO:0005737;
GO  GO:0005789;
GO  GO:0031309;
GO  GO:0043227;
GO  GO:0005640;
GO  GO:0034998;
GO  GO:0032991;
GO  GO:0006998;
GO  GO:0007097;
GO  GO:0006487;
TP  Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255};
SQ  MDVMQRYVSPVNPAVFPHLATVLLVIGTFFTAWFFIFVVSRKSSKESTLIKELLISLCASIFLGFGIVFLLLTVGIYV
//