ID  Q9VYX1;
PN  Enhancer of yellow 2 transcription factor;
GN  e;
OS  7227;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0182;
SL  Comments: Nucleus, nucleoplasm {ECO:0000255|HAMAP- Rule:MF_03046, ECO:0000269|PubMed:17643381, ECO:0000269|PubMed:20048002}. Cytoplasm {ECO:0000255|HAMAP- Rule:MF_03046, ECO:0000269|PubMed:27016737}. Nucleus membrane {ECO:0000269|PubMed:18034162, ECO:0000269|PubMed:20048002, ECO:0000269|PubMed:27016737}; Peripheral membrane protein {ECO:0000269|PubMed:18034162, ECO:0000269|PubMed:20048002, ECO:0000269|PubMed:27016737}. Nucleus {ECO:0000269|Ref.11}. Note=Localizes to nuclear periphery, in contact with the nuclear pore complex (NPC). {ECO:0000269|PubMed:18034162, ECO:0000269|PubMed:20048002}.
DR  UNIPROT: Q9VYX1;
DR  Pfam: PF10163;
DE  Function: Involved in mRNA export coupled transcription activation by association with both the TREX-2/AMEX and the SAGA complexes (PubMed:18034162, PubMed:19947544, PubMed:27016737). The SAGA complex is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination (PubMed:11438676, PubMed:18206972). Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B (PubMed:18206972). The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription (PubMed:18034162, PubMed:19947544). Required for nuclear receptor- mediated transactivation (PubMed:20714859, PubMed:20048002). Involved in transcription elongation by recruiting the THO complex onto nascent mRNA (PubMed:20048002). The TREX-2/AMEX complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket) (PubMed:27016737). TREX-2/AMEX participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery (PubMed:17643381, PubMed:27016737). Recruited to the su(Hw) insulators via its interaction with su(Hw) and participates in the barrier activity of such insulators (PubMed:17643381). In contrast, it does not participate in the enhancer-blocking activity of the su(Hw) insulators (PubMed:17643381). {ECO:0000269|PubMed:11438676, ECO:0000269|PubMed:17643381, ECO:0000269|PubMed:18034162, ECO:0000269|PubMed:18206972, ECO:0000269|PubMed:19947544, ECO:0000269|PubMed:20048002, ECO:0000269|PubMed:20714859, ECO:0000269|PubMed:27016737}.
DE  Reference Proteome: Yes;
DE  Interaction: Q7JXF5; IntAct: EBI-2550835; Score: 0.46
DE  Interaction: Q9U3V9; IntAct: EBI-2550885; Score: 0.54
DE  Interaction: Q9U5W9; IntAct: EBI-2550010; Score: 0.35
DE  Interaction: Q8I8U7; IntAct: EBI-2550010; Score: 0.35
DE  Interaction: O76216; IntAct: EBI-2550010; Score: 0.43
DE  Interaction: Q8I8V0; IntAct: EBI-2550010; Score: 0.35
DE  Interaction: Q9VZJ9; IntAct: EBI-15145789; Score: 0.67
DE  Interaction: Q9U6R9; IntAct: EBI-15171898; Score: 0.49
DE  Interaction: Q9VI64; IntAct: EBI-15172342; Score: 0.49
DE  Interaction: Q9VVR6; IntAct: EBI-15172118; Score: 0.49
DE  Interaction: Q9VRY7; IntAct: EBI-15172566; Score: 0.67
DE  Interaction: P98149; IntAct: EBI-26728176; Score: 0.49
DE  Interaction: P49905; IntAct: EBI-26751710; Score: 0.49
DE  Interaction: Q9VGG3; IntAct: EBI-26795784; Score: 0.49
DE  Interaction: Q9VE51; IntAct: EBI-26806623; Score: 0.49
DE  Interaction: Q8IP15; IntAct: EBI-26838266; Score: 0.49
GO  GO:0000785;
GO  GO:0005737;
GO  GO:0071819;
GO  GO:0034399;
GO  GO:0005643;
GO  GO:0005634;
GO  GO:0000124;
GO  GO:0070390;
GO  GO:0070742;
GO  GO:0003682;
GO  GO:0043035;
GO  GO:0030374;
GO  GO:0001094;
GO  GO:0003713;
GO  GO:0033696;
GO  GO:0016578;
GO  GO:0006406;
GO  GO:0016973;
GO  GO:0045893;
GO  GO:0045944;
GO  GO:0015031;
GO  GO:0006357;
GO  GO:0006368;
TP  Membrane Topology: Peripheral; Source: UniProt - Sequence Analysis;
SQ  MSTSGAVDQYTVLTGDRSKIKDLLCSRLTECGWRDEVRLMCRNILMEKGTNNSFTVEQLIAEVTPKARTLVPDAVKKELL
SQ  MKIRTILTEIEEEPDEPEDES
//