ID Q9WTV1; PN Chitinase-3-like protein 1; GN Chi3l1; OS 10116; SL Nucleus Position: SL-0198; SL Comments: Secreted, extracellular space {ECO:0000250}. Cytoplasm {ECO:0000250}. Cytoplasm, perinuclear region {ECO:0000250}. Endoplasmic reticulum {ECO:0000250}. DR UNIPROT: Q9WTV1; DR UNIPROT: Q5BJR6; DR Pfam: PF00704; DR PROSITE: PS51910; DE Function: Carbohydrate-binding lectin with a preference for chitin. Has no chitinase activity. May play a role in tissue remodeling and in the capacity of cells to respond to and cope with changes in their environment. Plays a role in T-helper cell type 2 (Th2) inflammatory response and IL-13-induced inflammation, regulating allergen sensitization, inflammatory cell apoptosis, dendritic cell accumulation and M2 macrophage differentiation. Facilitates invasion of pathogenic enteric bacteria into colonic mucosa and lymphoid organs. Mediates activation of AKT1 signaling pathway and subsequent IL8 production in colonic epithelial cells. Regulates antibacterial responses in lung by contributing to macrophage bacterial killing, controlling bacterial dissemination and augmenting host tolerance. Also regulates hyperoxia- induced injury, inflammation and epithelial apoptosis in lung (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0005783; GO GO:0005576; GO GO:0005615; GO GO:0048471; GO GO:0030246; GO GO:0008061; GO GO:0007250; GO GO:0006915; GO GO:0005975; GO GO:0071347; GO GO:0071356; GO GO:0006032; GO GO:0006954; GO GO:0030324; GO GO:0045766; GO GO:0070374; GO GO:0032757; GO GO:0010800; GO GO:0051897; GO GO:0070555; GO GO:0070741; GO GO:0009612; GO GO:0034612; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MTLQLPGFAVLMLLQSCSAYKLVCYYTNWSQYREGNGSCFPDALDHSLCTHIIYSFANISNNKLSTSEWNDVTLYGMLNT SQ LKTRNPRLKTLLSVGGWSFGSERFSRIVSNAKSRKTFVQSVAPFLRTYGFDGLDLAWLYPGPKDKQHFTTLIKELKAEFT SQ KEVQPGTEKLLLSAAVSAGKVTLDSGYDVAQIAQHLDFINLMTYDFHGTWRHTTGHHSPLFRGQQDTGPDRFSNVDYGVG SQ YMLRLGAPTNKLVMGIPTFGKSFTLASSENQVGAPITGSGLPGRYTKEKGTLAYYEICDFLRGAEVHRILGQQVPFATKG SQ NQWVGYDDPESVKNKVKYLKNKQLAGAMVWAVDLDDFRGSFCGHNVHFPLTNAIKEALAVA //