ID Q9XXN3; PN Nuclear envelope phosphatase-regulatory subunit 1 homolog; GN nepr; OS 6239; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Nucleus membrane {ECO:0000250|UniProtKB:Q8N9A8}; Multi-pass membrane protein {ECO:0000250|UniProtKB:Q8N9A8}. Cytoplasm {ECO:0000250|UniProtKB:Q8N9A8}. DR UNIPROT: Q9XXN3; DR Pfam: PF09771; DE Function: May form with the serine/threonine protein phosphatase scpl-2 an active complex dephosphorylating and activating lipin-like phosphatases. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at different levels. May play a role in nuclear membrane dynamics being crucial for early development of the embryo. {ECO:0000269|PubMed:22134922}. DE Reference Proteome: Yes; DE Interaction: O45734; IntAct: EBI-341939; Score: 0.00 GO GO:0005737; GO GO:0016021; GO GO:0071595; GO GO:0031965; GO GO:0006629; GO GO:0035307; GO GO:0010867; GO GO:0051783; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MAIQARRMPEDPSTACEDLKFFEKRLTEVITYMGPTCTRWRIAIVIFAVLVGVIGSKYFANEKIEIFQIPMIDMFLTTHL SQ DFTLCFFVGLLLFAVFGVHRRIVAPTIVARRCRDALSPFSLSCDHNGKLIVKPAVRNSAP //