ID Q9YGI5; PN Deoxyribonuclease-1; GN DNASE1; OS 9031; SL Nucleus Position: SL-0178; SL Comments: Secreted {ECO:0000250|UniProtKB:P24855}. Zymogen granule {ECO:0000250|UniProtKB:P24855}. Nucleus envelope {ECO:0000250|UniProtKB:P24855}. Note=Secretory protein, stored in zymogen granules and found in the nuclear envelope. {ECO:0000250|UniProtKB:P24855}. DR UNIPROT: Q9YGI5; DR Pfam: PF03372; DR PROSITE: PS00919; DR PROSITE: PS00918; DE Function: Serum endocuclease secreted into body fluids by a wide variety of exocrine and endocrine organs (PubMed:12739897). Expressed by non-hematopoietic tissues and preferentially cleaves protein-free DNA (By similarity). Among other functions, seems to be involved in cell death by apoptosis (By similarity). Binds specifically to G-actin and blocks actin polymerization (By similarity). {ECO:0000250|UniProtKB:P21704, ECO:0000250|UniProtKB:P24855, ECO:0000269|PubMed:12739897}. DE Reference Proteome: Yes; GO GO:0005576; GO GO:0005635; GO GO:0042588; GO GO:0003779; GO GO:0004530; GO GO:0006915; GO GO:0000737; GO GO:0002283; GO GO:0002673; GO GO:0070948; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MARLVLELLAAALLLRVAATLRISAFNIRTFGDSKMSNQTVAGFIVSILVQYDITLVQEVRDADLSSVKKLVSQLNSASS SQ YPYSFLSSIPLGRNSYKEQYVFIYRSDIVSVLESYYYDDGCESCGTDIFSREPFIVKFSSPTTQLDEFVIVPLHAEPSSA SQ PAEINALTDVYTDVINKWETNNIFFMGDFNADCSYVTAEQWPSIRLRSLSSCEWLIPDSADTTVTSTDCAYDRIVACGSA SQ LRQAVEYGSATVNNFQETLRIQNKDALAISDHFPVEVTLKAR //