ID  Q9Z0F7;
PN  Gamma-synuclein;
GN  Sncg;
OS  10090;
SL  Nucleus Position: SL-0198;
SL  Comments: Cytoplasm, perinuclear region {ECO:0000250}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {ECO:0000250}. Cytoplasm, cytoskeleton, spindle {ECO:0000250}. Note=Associated with centrosomes in several interphase cells. In mitotic cells, localized to the poles of the spindle (By similarity). {ECO:0000250}.
DR  UNIPROT: Q9Z0F7;
DR  Pfam: PF01387;
DE  Function: Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway (By similarity). {ECO:0000250}.
DE  Reference Proteome: Yes;
GO  GO:0030424;
GO  GO:0043679;
GO  GO:0005737;
GO  GO:0005815;
GO  GO:0043025;
GO  GO:0048471;
GO  GO:0005886;
GO  GO:0005819;
GO  GO:0043014;
GO  GO:0048487;
GO  GO:1903136;
GO  GO:0008344;
GO  GO:0007268;
GO  GO:1901215;
GO  GO:0009306;
GO  GO:0014059;
GO  GO:1901214;
GO  GO:0046928;
GO  GO:0050808;
GO  GO:0048488;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVANK
SQ  TVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEENEEAKSGED
//