ID Q9Z142; PN Transmembrane protein 33; GN Tmem33; OS 10116; SL Nucleus Position: SL-0178; SL Comments: Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:P57088}; Multi-pass membrane protein {ECO:0000255}. Melanosome {ECO:0000250|UniProtKB:P57088}. Nucleus envelope {ECO:0000250|UniProtKB:P57088}. Note=Co-localizes with RTN4 at the ER sheets. {ECO:0000250|UniProtKB:P57088}. DR UNIPROT: Q9Z142; DR Pfam: PF03661; DE Function: Acts as a regulator of the tubular endoplasmic reticulum (ER) network by modulating intracellular calcium homeostasis. Mechanistically, stimulates PKD2 calcium-dependent activity (By similarity). Suppresses the RTN3/4-induced formation of the ER tubules. Positively regulates PERK-mediated and IRE1-mediated unfolded protein response signaling. Plays an essential role in VEGF-mediated release of Ca(2+) from ER stores during angiogenesis. Also plays a role in the modulation of innate immune signaling through the cGAS-STING pathway by interacting with RNF26. Participates in lipid metabolism by acting as a downstream effector of the pyruvate kinase/PKM. Forms a complex with RNF5 to facilitate polyubiquitination and subsequent degradation of SCAP on the ER membrane (By similarity). {ECO:0000250|UniProtKB:P57088, ECO:0000250|UniProtKB:Q9CR67}. DE Reference Proteome: Yes; DE Interaction: Q9EQU3; IntAct: EBI-9979662; Score: 0.35 DE Interaction: P11362; IntAct: EBI-22243924; Score: 0.35 GO GO:0005783; GO GO:0005789; GO GO:0030176; GO GO:0042470; GO GO:0005635; GO GO:0071786; GO GO:0045087; GO GO:0061024; GO GO:1903896; GO GO:1903899; GO GO:1903371; GO GO:0034976; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALLANALTSALRLHQRLPHFQLS SQ RAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSLLHAATYTKKVLDAKGSNSLPLLRSVLDKLSTNQQNILKFI SQ ACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCRNLFNELRIVVEHIIMKPSCPLFVRRLCLQSIAFIS SQ RLAPTVA //