ID Q9Z1D1; PN Eukaryotic translation initiation factor 3 subunit G; GN Eif3g; OS 10090; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_03006}. Nucleus {ECO:0000255|HAMAP-Rule:MF_03006}. Cytoplasm, perinuclear region {ECO:0000255|HAMAP-Rule:MF_03006}. Note=Colocalizes with AIFM1 in the nucleus and perinuclear region. {ECO:0000255|HAMAP- Rule:MF_03006}. DR UNIPROT: Q9Z1D1; DR UNIPROT: Q9R079; DR Pfam: PF12353; DR Pfam: PF00076; DR PROSITE: PS50102; DE Function: RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre- initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression. This subunit can bind 18S rRNA. {ECO:0000255|HAMAP-Rule:MF_03006, ECO:0000269|PubMed:17581632}. DE Reference Proteome: Yes; DE Interaction: Q3TBT3; IntAct: EBI-10729637; Score: 0.35 DE Interaction: Q9QWV4; IntAct: EBI-767142; Score: 0.37 DE Interaction: Q9JL25; IntAct: EBI-649611; Score: 0.37 DE Interaction: P23116; IntAct: EBI-7466744; Score: 0.46 DE Interaction: Q9H074; IntAct: EBI-10766353; Score: 0.35 DE Interaction: Q9EPK7; IntAct: EBI-17171503; Score: 0.35 DE Interaction: P97414; IntAct: EBI-20564572; Score: 0.35 GO GO:0005737; GO GO:0005829; GO GO:0016282; GO GO:0033290; GO GO:0005852; GO GO:0005634; GO GO:0048471; GO GO:0003723; GO GO:0003743; GO GO:0001732; GO GO:0006413; GO GO:0075525; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MPTGDFDSKPSWADQVEEEGEDDKCVTSELLKGIPLPTGDTSPEPELLPGDPLPPPKEVINGNIKTVTEYKIEEDGKKFK SQ IVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRIC SQ KGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQAAQSKTGKYVPPSLRDGASRRGESMQPNRRADDNAT SQ IRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN //