ID  Q9Z2F7;
PN  BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like;
GN  Bnip3l;
OS  10090;
SL  Nucleus Position: SL-0178;
SL  Comments: Nucleus envelope {ECO:0000250}. Endoplasmic reticulum {ECO:0000250}. Mitochondrion outer membrane {ECO:0000250}. Membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. Note=Colocalizes with SPATA18 at the mitochondrion outer membrane. {ECO:0000250}.
DR  UNIPROT: Q9Z2F7;
DR  UNIPROT: Q545J6;
DR  Pfam: PF06553;
DE  Function: Induces apoptosis. Interacts with viral and cellular anti- apoptosis proteins. Can overcome the suppressors BCL-2 and BCL-XL, although high levels of BCL-XL expression will inhibit apoptosis. Inhibits apoptosis induced by BNIP3. Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates in mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane regulates the opening of a pore in the mitochondrial double membrane in order to mediate the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix (By similarity). May function as a tumor suppressor (By similarity). {ECO:0000250}.
DE  Reference Proteome: Yes;
DE  Interaction: Q69ZI1; IntAct: EBI-1774643; Score: 0.58
DE  Interaction: Q9GZQ8; IntAct: EBI-7679879; Score: 0.61
DE  Interaction: Q9H0R8; IntAct: EBI-7679924; Score: 0.57
DE  Interaction: P60520; IntAct: EBI-7679985; Score: 0.54
DE  Interaction: O95166; IntAct: EBI-7679950; Score: 0.54
DE  Interaction: Q9H492; IntAct: EBI-7680044; Score: 0.65
DE  Interaction: P38182; IntAct: EBI-7680182; Score: 0.44
GO  GO:0005829;
GO  GO:0005783;
GO  GO:0016021;
GO  GO:0005741;
GO  GO:0005739;
GO  GO:0005635;
GO  GO:0016607;
GO  GO:0005634;
GO  GO:0042802;
GO  GO:0005521;
GO  GO:0042803;
GO  GO:0071456;
GO  GO:0051607;
GO  GO:0097345;
GO  GO:0035694;
GO  GO:0043066;
GO  GO:0060548;
GO  GO:0010917;
GO  GO:0043065;
GO  GO:0016239;
GO  GO:0035794;
GO  GO:1903146;
GO  GO:0043067;
GO  GO:1903214;
TP  Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255};
SQ  MSHLVEPPPPLHNNNNNCEEGEQPLPPPAGLNSSWVELPMNSSNGNENGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHE
SQ  SGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHP
SQ  KRAASLSMRKSGAMKKGGIFSAEFLKVFIPSLFLSHVLALGLGIYIGKRLSTPSASTY
//