P03519 Matrix M 11285 None SL-0415 SL-0418 Virion membrane; Peripheral membrane protein {ECO:0000269|PubMed:1850035}. Host endomembrane system; Peripheral membrane protein. Host nucleus membrane; Peripheral membrane protein. Host nucleus {ECO:0000269|PubMed:28888655}. Host cytoplasm {ECO:0000269|PubMed:28888655}. UNIPROT P03519 Pfam PF06326 Plays a major role in assembly and budding of virion, by recruiting cellular partners of the ESCRT complexes that play a key role in releasing the budding particle from the host membrane. Condensates the ribonucleocapsid core during virus assembly. {ECO:0000269|PubMed:16298982, ECO:0000269|PubMed:20943988}. Inhibits mRNA nuclear export through direct interaction with host RAE1-NUP98 complex, thereby preventing interferon signaling and establishment of antiviral state in infected cells (PubMed:15629720, PubMed:33849972). Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell (PubMed:15629720). Inhibits host transcription, possibly through interaction with host DNA repair factor IIH/TFIIH GTF2H5 subunit (PubMed:28888655). {ECO:0000269|PubMed:15629720, ECO:0000269|PubMed:28888655, ECO:0000269|PubMed:33849972}. Q9BUJ2 EBI-7228130 0.40 P78406 EBI-7228174 0.53 P52948 EBI-7228174 0.53 GO:0030430 GO:0044200 GO:0016020 GO:0019031 GO:0055036 GO:0039660 GO:0016310 GO:0039522 GO:0039602 GO:0039702 Peripheral UniProt Experimental Evidence {ECO:0000269|PubMed:1850035} MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTYDPNQLRYEKFFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHTHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEKKASGAWVLDSISHFK 229