P20292 Arachidonate ALOX5AP 9606 None SL-0178 SL-0182 Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. UNIPROT P20292 UNIPROT Q5VV04 PDB 2Q7M PDB 2Q7R PDB 6VGC PDB 6VGI Pfam PF01124 PROSITE PS01297 OMIM 601367 OMIM 603700 DisGeNET 241 Required for leukotriene biosynthesis by ALOX5 (5- lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes. {ECO:0000269|PubMed:2300173, ECO:0000269|PubMed:8440384}. Ischemic stroke (ISCHSTR) [MIM:601367]: A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors. Note=Disease susceptibility is associated with variants affecting the gene represented in this entry. Note=Genetic variations in ALOX5AP may be associated with susceptibility to myocardial infarction. Involvement in myocardial infarction is however unclear: according to some authors (PubMed:14770184), a 4-SNP haplotype in ALOX5AP confers risk of myocardial infarction, while according to other (PubMed:17304054) ALOX5AP is not implicated in this condition. {ECO:0000269|PubMed:14770184, ECO:0000269|PubMed:17304054}. A0PK00 EBI-24765164 0.56 O00299 EBI-3904626 0.37 Q9H115 EBI-24738406 0.56 Q96FB2 EBI-24768960 0.56 O15529 EBI-24778364 0.56 P35372 EBI-24571720 0.56 Q13520 EBI-24799898 0.56 O15552 EBI-24808129 0.56 Q70Z53 EBI-21893005 0.40 P20292 EBI-26452342 0.40 GO:0005829 GO:0005783 GO:0005789 GO:0016021 GO:0016020 GO:0005635 GO:0031965 GO:0004051 GO:0050544 GO:0008047 GO:0019899 GO:0004602 GO:0004364 GO:0042802 GO:0004464 GO:0047485 GO:0044877 GO:0071277 GO:0019370 GO:0002540 GO:0019372 GO:0002675 GO:0070207 Transmembrane UniProt Sequence Analysis MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP 161