P40305 Interferon IFI27 9606 None SL-0178 SL-0179 SL-0182 Mitochondrion membrane {ECO:0000269|PubMed:18330707, ECO:0000269|PubMed:27673746}; Multi-pass membrane protein {ECO:0000255}. Nucleus inner membrane {ECO:0000269|PubMed:11722583, ECO:0000269|PubMed:22427340}; Multi-pass membrane protein {ECO:0000255}. Endoplasmic reticulum membrane {ECO:0000269|PubMed:22427340}; Multi-pass membrane protein {ECO:0000255}. Note=Exclusive localizations in either the nucleus or the mitochondrion have been reported. {ECO:0000269|PubMed:22427340, ECO:0000269|PubMed:27673746}. UNIPROT P40305 UNIPROT A0A087WZF8 UNIPROT A8K0H0 UNIPROT Q53YA6 UNIPROT Q6IEC1 UNIPROT Q7Z5R0 UNIPROT Q7Z5R1 UNIPROT Q7Z5R2 UNIPROT Q96BK3 UNIPROT Q9H4B1 Pfam PF06140 OMIM 600009 DisGeNET 3429 Probable adapter protein involved in different biological processes (PubMed:22427340, PubMed:27194766). Part of the signaling pathways that lead to apoptosis (PubMed:18330707, PubMed:27673746, PubMed:24970806). Involved in type-I interferon-induced apoptosis characterized by a rapid and robust release of cytochrome C from the mitochondria and activation of BAX and caspases 2, 3, 6, 8 and 9 (PubMed:18330707, PubMed:27673746). Also functions in TNFSF10-induced apoptosis (PubMed:24970806). May also have a function in the nucleus, where it may be involved in the interferon-induced negative regulation of the transcriptional activity of NR4A1, NR4A2 and NR4A3 through the enhancement of XPO1-mediated nuclear export of these nuclear receptors (PubMed:22427340). May thereby play a role in the vascular response to injury (By similarity). In the innate immune response, has an antiviral activity towards hepatitis C virus/HCV (PubMed:27194766, PubMed:27777077). May prevent the replication of the virus by recruiting both the hepatitis C virus non-structural protein 5A/NS5A and the ubiquitination machinery via SKP2, promoting the ubiquitin- mediated proteasomal degradation of NS5A (PubMed:27194766, PubMed:27777077). {ECO:0000250|UniProtKB:Q8R412, ECO:0000269|PubMed:18330707, ECO:0000269|PubMed:22427340, ECO:0000269|PubMed:24970806, ECO:0000269|PubMed:27194766, ECO:0000269|PubMed:27673746, ECO:0000269|PubMed:27777077}. P02545 EBI-27124576 0.40 Q5NGF6 EBI-2805959 0.00 Q81KT8 EBI-2831742 0.00 A0A6H3ABE4 EBI-2831749 0.00 A0A6L7HHX2 EBI-2831761 0.00 A0A6L7HB40 EBI-2831768 0.00 Q8ZCW0 EBI-2847220 0.00 A0A5P8YAW1 EBI-2867067 0.00 A0A380PNP6 EBI-2867060 0.00 P17778 EBI-2867046 0.00 A0A3N4BEU0 EBI-2867053 0.00 Q8ZG09 EBI-2867074 0.00 Q8ZHF1 EBI-2867081 0.00 P05549 EBI-9679979 0.37 Q92754 EBI-9680053 0.37 P55056 EBI-24754759 0.56 P22736 EBI-27124261 0.61 GO:0005789 GO:0016021 GO:0031966 GO:0005741 GO:0005739 GO:0005635 GO:0005637 GO:0042802 GO:0005521 GO:0061629 GO:0006915 GO:0097190 GO:0051607 GO:0097191 GO:0045087 GO:0044827 GO:0000122 GO:0043161 GO:0070936 GO:0046825 GO:0060337 Transmembrane UniProt Sequence Analysis {ECO:0000255} MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY 122