Q07937 Nanos nanos1 8355 None SL-0198 Cytoplasm {ECO:0000250}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:21195170}. Note=During early cleavage and blastula stages found close to the cell periphery in a germ plasm-like pattern. From gastrula stage on, detected predominantly in a perinuclear region. UNIPROT Q07937 Pfam PF05741 PROSITE PS51522 Acts as a translational repressor. Can mediate repression affecting different steps in the translation process: cap-driven, IRES- driven, polyadenylated RNAs or nonpolyadenylated RNAs. Essential for the development of primordial germ cells (PGCs) by ensuring their proper migration and survival. {ECO:0000269|PubMed:21195170}. Q9DEB9 EBI-7812774 0.54 GO:0005737 GO:0060293 GO:0048471 GO:0003723 GO:0030371 GO:0008270 GO:0007281 GO:0008354 Unknown UniProt Sequence Analysis MDGGLCFDSWSDYLGLSSLISRGLQPQREGERPRWDVLSPASAEPLPSNESVGHKGCGFCRSNREALSLYTSHRLRALDGRVLCPVLRGYTCPLCGANGDWAHTMRYCPLRRLLRDPQSNSNNPKLRH 128