Q0P5D3 G1/S-specific CCND2 9913 None SL-0178 SL-0182 Nucleus {ECO:0000250|UniProtKB:P30279}. Cytoplasm {ECO:0000250|UniProtKB:P30279}. Nucleus membrane {ECO:0000250|UniProtKB:P30279}. Note=Cyclin D-CDK4 complexes accumulate at the nuclear membrane and are then translocated into the nucleus through interaction with KIP/CIP family members. {ECO:0000250|UniProtKB:P30279}. UNIPROT Q0P5D3 Pfam PF02984 Pfam PF00134 PROSITE PS00292 Regulatory component of the cyclin D2-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. {ECO:0000250|UniProtKB:P30279}. GO:0000785 GO:0097129 GO:0000307 GO:0005737 GO:0005829 GO:0031965 GO:0005730 GO:0005654 GO:0005634 GO:0016538 GO:0019901 GO:0008344 GO:0051301 GO:0071481 GO:0007616 GO:0044772 GO:0043066 GO:0008284 GO:0045737 GO:1900087 GO:0000079 Unknown UniProt Sequence Analysis MELLCGEVEPVRRAVPDANLLHDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAINYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQPSEKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEDVSSLTGDALVDLLAKITNTDVDCLKACQEQIEVVLLNSLQQYRQDQGDGSKSEDELDQASTPTDVRDIDL 289