Q2M2T9 Telomere TERB2 9913 None SL-0178 SL-0179 SL-0182 Chromosome, telomere {ECO:0000250|UniProtKB:Q9D494}. Nucleus inner membrane {ECO:0000250|UniProtKB:Q9D494}. Note=Localizes to telomeres throughout meiotic prophase I and disappears in metaphase I. In leptotene spermatocytes, localizes to telomeres that localize to the nucleus inner membrane. {ECO:0000250|UniProtKB:Q9D494}. UNIPROT Q2M2T9 Pfam PF15101 Meiosis-specific telomere-associated protein involved in meiotic telomere attachment to the nucleus inner membrane, a crucial step for homologous pairing and synapsis. Component of the MAJIN-TERB1- TERB2 complex, which promotes telomere cap exchange by mediating attachment of telomeric DNA to the inner nuclear membrane and replacement of the protective cap of telomeric chromosomes: in early meiosis, the MAJIN-TERB1-TERB2 complex associates with telomeric DNA and the shelterin/telosome complex. During prophase, the complex matures and promotes release of the shelterin/telosome complex from telomeric DNA. {ECO:0000250|UniProtKB:Q9D494}. GO:0000781 GO:0005637 GO:0007129 GO:0070197 GO:0045141 Unknown UniProt Sequence Analysis MFQGQRGWFCGSVSHDLRQFWVAEGGTISDPRAADFLFSCDASHPDTLRIYQSLDYIEDNATVFHAYYLSAVANAEIKNSVALGHFILPPASLQKEIRRKIGSFIWEQDQHFLIEKHDEVTSNELKVFRESSVLATDHKKDLSKSTEKHFIRTPVVEKQMYFPLQHYPVNNMVTGYISIDAMKKFLGELHDFIPGSSGYLAYHVQNEINMSAIKNKLKNKY 221