Q3KP22 Membrane-anchored MAJIN 9606 None SL-0178 SL-0179 SL-0182 Nucleus inner membrane {ECO:0000250|UniProtKB:Q9D992}; Single-pass membrane protein {ECO:0000250|UniProtKB:Q9D992}. Chromosome, telomere {ECO:0000250|UniProtKB:Q9D992}. Note=In leptotene spermatocytes, localizes to telomeres that localize to the nucleus inner membrane. {ECO:0000250|UniProtKB:Q9D992}. UNIPROT Q3KP22 UNIPROT B3KS99 UNIPROT E9PPE5 PDB 6GNX PDB 6GNY PDB 6J08 Pfam PF15077 OMIM 617130 DisGeNET 283129 Meiosis-specific telomere-associated protein involved in meiotic telomere attachment to the nucleus inner membrane, a crucial step for homologous pairing and synapsis. Component of the MAJIN-TERB1- TERB2 complex, which promotes telomere cap exchange by mediating attachment of telomeric DNA to the inner nuclear membrane and replacement of the protective cap of telomeric chromosomes: in early meiosis, the MAJIN-TERB1-TERB2 complex associates with telomeric DNA and the shelterin/telosome complex. During prophase, the complex matures and promotes release of the shelterin/telosome complex from telomeric DNA. In the complex, MAJIN acts as the anchoring subunit to the nucleus inner membrane. MAJIN shows DNA-binding activity, possibly for the stabilization of telomere attachment on the nucleus inner membrane. {ECO:0000250|UniProtKB:Q9D992}. P27658 EBI-24669930 0.56 Q9BSW7 EBI-24682491 0.56 Q8NHR7 EBI-23751777 0.56 Q9Y5W9 EBI-24744300 0.56 Q86WT6 EBI-24767358 0.56 O43741 EBI-24773475 0.56 P53350 EBI-21859936 0.35 P26998 EBI-21859936 0.35 GO:0000781 GO:0005639 GO:0003677 GO:0007129 GO:0070197 GO:0045141 Transmembrane UniProt Sequence Analysis {ECO:0000255} MSLKPFTYPFPETRFLHAGPNVYKFKIRYGKSIRGEEIENKEVITQELEVPVEKKAVGAVMRKRKHMDEPSSPSRPGLDRAKIGTSSQGPSKKKPPVETRRNRERKTQQGLQETLASDITDVQKQDSEWGHSLPGRIVPPLQHNSPPPKERAATGFFGFLSSLFPFRYFFRKSSHS 176