Q3MHW7 Sigma TMEM97 9913 None SL-0178 SL-0182 Nucleus membrane {ECO:0000250|UniProtKB:Q5BJF2}; Multi-pass membrane protein {ECO:0000255}. Rough endoplasmic reticulum membrane {ECO:0000250|UniProtKB:Q5BJF2}; Multi-pass membrane protein {ECO:0000255}. Note=Localized at cell membrane and in lysosomes in sterol-depleted cells when expression of endogenous TMEM97 is stimulated. {ECO:0000250|UniProtKB:Q5BJF2}. UNIPROT Q3MHW7 UNIPROT A1L510 PDB 7M93 PDB 7M94 PDB 7M95 PDB 7M96 PDB 7MFI PROSITE PS51751 Intracellular orphan receptor that binds numerous drugs and which is highly expressed in various proliferating cells. Corresponds to the sigma-2 receptor, which is thought to play important role in regulating cell survival, morphology and differentiation. May play a role as a regulator of cellular cholesterol homeostasis. May function as sterol isomerase. May alter the activity of some cytochrome P450 proteins. {ECO:0000269|PubMed:28559337}. GO:0005783 GO:0016021 GO:0005764 GO:0031965 GO:0005886 GO:0005791 GO:0030867 GO:0042632 Transmembrane UniProt Sequence Analysis {ECO:0000255} MGTLGARRGLEWFLGFYFLSHIPITLLMDLQGVLPRDLYPVELRNLQQWYIEEFKDPLLQTPPAWFKSFLFCELVFQLPFFPIAAYAFFKGGCKWIRTPAIIYSVHTMTTLIPILSTLLLDDFSKASHFRGQGPKTFQERLFLISVYIPYFLIPLILLLFMVRNPYYKSEEKRKKK 176