Q6DEP7 Small sumo1 8364 None SL-0178 SL-0182 Nucleus membrane {ECO:0000250|UniProtKB:P63165}. Nucleus speckle {ECO:0000250|UniProtKB:P63166}. Cytoplasm {ECO:0000250|UniProtKB:P63165}. Nucleus, PML body {ECO:0000250|UniProtKB:P63165}. Cell membrane {ECO:0000250|UniProtKB:P63165}. Nucleus {ECO:0000250|UniProtKB:P63165}. UNIPROT Q6DEP7 Pfam PF11976 PROSITE PS50053 Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer (By similarity). Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex sae1-sae2 and linkage to the E2 enzyme ube2i. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric sumo1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins (By similarity). {ECO:0000250|UniProtKB:O57686, ECO:0000250|UniProtKB:P63165}. GO:0005737 GO:0031965 GO:0016607 GO:0097165 GO:0005634 GO:0005886 GO:0016605 GO:0031386 GO:0008134 GO:0044389 GO:0071276 GO:0034605 GO:0016925 Unknown UniProt Sequence Analysis MSDQEAKPSSEDLGDKKEGGDYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRISDHQTPKELGMEEEDVIEVYQEQTGGHSTI 102