Q8NHR7 Telomere TERB2 9606 None SL-0178 SL-0179 SL-0182 Chromosome, telomere {ECO:0000250|UniProtKB:Q9D494}. Nucleus inner membrane {ECO:0000250|UniProtKB:Q9D494}. Note=Localizes to telomeres throughout meiotic prophase I and disappears in metaphase I. In leptotene spermatocytes, localizes to telomeres that localize to the nucleus inner membrane. {ECO:0000250|UniProtKB:Q9D494}. UNIPROT Q8NHR7 PDB 6GNX PDB 6GNY PDB 6J07 PDB 6J08 Pfam PF15101 OMIM 617131 OMIM 619645 Meiosis-specific telomere-associated protein involved in meiotic telomere attachment to the nucleus inner membrane, a crucial step for homologous pairing and synapsis. Component of the MAJIN-TERB1- TERB2 complex, which promotes telomere cap exchange by mediating attachment of telomeric DNA to the inner nuclear membrane and replacement of the protective cap of telomeric chromosomes: in early meiosis, the MAJIN-TERB1-TERB2 complex associates with telomeric DNA and the shelterin/telosome complex. During prophase, the complex matures and promotes release of the shelterin/telosome complex from telomeric DNA. {ECO:0000250|UniProtKB:Q9D494}. Spermatogenic failure 59 (SPGF59) [MIM:619645]: An autosomal recessive male infertility disorder characterized by non-obstructive azoospermia, due to sperm maturation arrest. {ECO:0000269|PubMed:33377991}. Note=The disease may be caused by variants affecting the gene represented in this entry. Q3KP22 EBI-23751777 0.56 GO:0000781 GO:0005637 GO:0007129 GO:0070197 GO:0045141 Unknown UniProt Sequence Analysis MFQGQRGWFCGSVSQDLRQFWVAEGGTISDPRAADFLFSCDASHPDTLRIYQSLDYIEDNATVFHAYYLSAVANAKIKNSVALGHFILPPACLQKEIRRKIGSFIWEQDQHFLIEKHDEVTPNEIKTLRENSELATEHKKELSKSPEKHFIRTPVVEKQMYFPLQNYPVNNMVTGYISIDAMKKFLGELHDFIPGTSGYLAYHVQNEINMSAIKNKLKRK 220