Q9CR67 Transmembrane Tmem33 10090 None SL-0178 Endoplasmic reticulum membrane {ECO:0000269|PubMed:31048699}; Multi-pass membrane protein {ECO:0000255}. Melanosome {ECO:0000250|UniProtKB:P57088}. Nucleus envelope {ECO:0000250|UniProtKB:P57088}. Note=Co-localizes with RTN4 at the ER sheets. {ECO:0000250|UniProtKB:P57088}. UNIPROT Q9CR67 UNIPROT Q544Q3 UNIPROT Q9D3M3 UNIPROT Q9DAV4 Pfam PF03661 Acts as a regulator of the tubular endoplasmic reticulum (ER) network by modulating intracellular calcium homeostasis. Mechanistically, stimulates PKD2 calcium-dependent activity (PubMed:31048699). Suppresses the RTN3/4-induced formation of the ER tubules. Positively regulates PERK-mediated and IRE1-mediated unfolded protein response signaling. Plays an essential role in VEGF-mediated release of Ca(2+) from ER stores during angiogenesis. Also plays a role in the modulation of innate immune signaling through the cGAS-STING pathway by interacting with RNF26. Participates in lipid metabolism by acting as a downstream effector of the pyruvate kinase/PKM. Forms a complex with RNF5 to facilitate polyubiquitination and subsequent degradation of SCAP on the ER membrane (By similarity). {ECO:0000250|UniProtKB:P57088, ECO:0000269|PubMed:31048699}. Q3TBT3 EBI-10729637 0.35 A0A0F6B1Q8 EBI-27035518 0.35 GO:0005783 GO:0005789 GO:0030176 GO:0042470 GO:0005635 GO:0071786 GO:0045087 GO:0061024 GO:1903896 GO:1903899 GO:1903371 GO:0034976 Transmembrane UniProt Sequence Analysis {ECO:0000255} MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALLANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSLLHAATYTKKVLDAKGSNSLPLLRSFLDKLSTNQQNILKFIACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCRNLFNELRIVVEHIIMKPSCPLFVRRLCLQSIAFISRLAPTVA 247