Q9D992 Membrane-anchored Majin 10090 None SL-0178 SL-0179 SL-0182 Nucleus inner membrane {ECO:0000269|PubMed:26548954}; Single-pass membrane protein {ECO:0000305|PubMed:26548954}. Chromosome, telomere {ECO:0000269|PubMed:26548954}. Note=Localizes to telomeres throughout meiotic prophase I and disappears in metaphase I. In leptotene spermatocytes, localizes to telomeres that localize to the nucleus inner membrane. {ECO:0000269|PubMed:26548954}. UNIPROT Q9D992 UNIPROT E9Q4N4 Pfam PF15077 Meiosis-specific telomere-associated protein involved in meiotic telomere attachment to the nucleus inner membrane, a crucial step for homologous pairing and synapsis. Component of the MAJIN-TERB1- TERB2 complex, which promotes telomere cap exchange by mediating attachment of telomeric DNA to the inner nuclear membrane and replacement of the protective cap of telomeric chromosomes: in early meiosis, the MAJIN-TERB1-TERB2 complex associates with telomeric DNA and the shelterin/telosome complex. During prophase, the complex matures and promotes release of the shelterin/telosome complex from telomeric DNA. In the complex, MAJIN acts as the anchoring subunit to the nucleus inner membrane. MAJIN shows DNA-binding activity, possibly for the stabilization of telomere attachment on the nucleus inner membrane. {ECO:0000269|PubMed:26548954}. GO:0000781 GO:0005639 GO:0003677 GO:0007129 GO:0070197 GO:0045141 Transmembrane UniProt Sequence Analysis {ECO:0000255} MSLKPFTYPFPETRFLHAGPNVYKFKIRYGNSIRGEEIEDKEVIVQELEDSIRAVLANMDSLQPFVTEHFIVFPYKSKWERVSHLKFKHGESILTPYPFVFTLYIEMKWFAEDLPSGKPADDIPLELVLAETEAEEATMRKWKRKLMEEPSSPSRQGPHRAKMETSSEASSNKKPLKESKRSTDEEAQQEYQDTPASNAIAVKEQDAALGHGLQGLVVPPLQHSSPPPPKEPGARGFLGFLSALFPFRYFFKKSGQ 256