Q9NZ50 Gamma-synuclein SNCG 9913 None SL-0198 Cytoplasm, perinuclear region {ECO:0000269|PubMed:11746666}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {ECO:0000269|PubMed:11746666}. Cytoplasm, cytoskeleton, spindle {ECO:0000269|PubMed:11746666}. Note=Associated with centrosomes in several interphase cells. In mitotic cells, localized to the poles of the spindle. UNIPROT Q9NZ50 UNIPROT Q1RMG7 UNIPROT Q9N187 Pfam PF01387 Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases (By similarity). May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway. {ECO:0000250}. GO:0043679 GO:0005737 GO:0005815 GO:0043025 GO:0048471 GO:0005819 GO:1903136 GO:0007268 GO:1901214 GO:0007165 GO:0050808 GO:0048488 Unknown UniProt Sequence Analysis MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKEGVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEVENIAVTSGVVHKEALKQPVPSQEDEAAKAEEQVAEETKSGGD 127