Q9VTL1 PCI PCID2 7227 None SL-0178 SL-0182 Nucleus {ECO:0000269|PubMed:18086857, ECO:0000269|PubMed:27016737}. Cytoplasm {ECO:0000269|PubMed:18086857, ECO:0000269|PubMed:33602059}. Nucleus membrane {ECO:0000269|PubMed:33602059}. Cytoplasm, cytoskeleton {ECO:0000269|PubMed:33602059}. Note=Shuttles in and out of the nucleus by a emb/Crm1-dependent mechanism (PubMed:18086857). The ubiquitinated forms are localized to the cytoplasm, the nonubiquitinated forms are localized to the nucleus, and both forms are associated with the nuclear membrane (PubMed:33602059). Associated with cytoplasmic microtubules (PubMed:33602059). Associates with mRNA in the nucleus and cytoplasm (PubMed:33602059). {ECO:0000269|PubMed:18086857, ECO:0000269|PubMed:33602059}. UNIPROT Q9VTL1 Pfam PF01399 PROSITE PS50250 Required for the export of nuclear mRNAs and involved in mRNA trafficking in the cytoplasm (PubMed:27016737, PubMed:28554770, PubMed:33602059). Component of the nuclear pore complex (NPC)- associated TREX-2/AMEX complex (anchoring and mRNA export complex) which functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket), thereby enabling the export of mRNAs to the cytoplasm through the nuclear pores (PubMed:27016737, PubMed:28554770, PubMed:33602059). Within the complex, specifically promotes the association of factors involved in regulating nuclear mRNA export, such as Moe, sbr/NXF1 and the ORC complex, to the mRNPs particles (PubMed:27016737, PubMed:28554770, PubMed:33602059). In the cytoplasm, functions independently of its role in the TREX-2/AMEX complex, to promote cytoplasmic mRNA trafficking together with nudC (PubMed:33602059). Associates with translationally active polysomes (PubMed:18086857). {ECO:0000269|PubMed:18086857, ECO:0000269|PubMed:27016737, ECO:0000269|PubMed:28554770, ECO:0000269|PubMed:33602059}. Q9VM46 EBI-15146793 0.62 O18388 EBI-258749 0.00 GO:0005737 GO:0005856 GO:0031965 GO:0005634 GO:0005844 GO:0070390 GO:0003690 GO:0019904 GO:0003723 GO:0006406 GO:0016973 GO:0000973 GO:0015031 GO:0006417 GO:0006368 Unknown UniProt Sequence Analysis MFGTVNNYLSGVLHAAQDLDGESLATYLSLRDVHVQNHNLYIAQPEKLVDRFLKPPLDEVVSAHLKVLYHLAQEPPGYMEAYTQQSAACGAVVRLLQQLKDENWCLPLMYRVCLDLRYLAQACEKHCQGFTPGHVLEKAADCIMACFRVCAADGRASEEDTKRLGMMNLVNQLFKIYFRINKLHLCKPLIRAIDNCIFKDSFPLPEQITYKYFVGRRAMFDSNYQAAVQYLSYAFSNCPDRFASNKRLILIYLVPVKMLLGYLPSKSLLQRYDLLLFLDLAMAMKAGNVNRFDEIVRDQELVLIRSGIYLLVEKLKFLVYRNLFKKVFVIRKSHQLDMGDFLSALHFVGLTDVSLDETHCIVANLIYDGKIKGYISHAHNKLVVSKQNPFPSVSL 395