Phospholipid scramblase 1 - Homo sapiens

Phospholipid scramblase 1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Phospholipid scramblase 1
Accession Code	O15162
Gene	PLSCR1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 318)
MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGA AGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPF TLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCC GDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFESTGSQEQKSGVW

Structure Viewer (PDB: 1Y2A)

Subcellular Location

Description
Cell membrane {Experimental EvidencePubMed:12564925, Experimental EvidencePubMed:22052202, Experimental EvidencePubMed:23590222, Experimental EvidencePubMed:24648509, Experimental EvidencePubMed:26745724}; Single-pass type II membrane protein {Experimental EvidencePubMed:26745724}. Cell membrane {Experimental EvidencePubMed:12564925}; Lipid-anchor {ECO:0000305\|PubMed:12564925}; Cytoplasmic side. Nucleus {Experimental EvidencePubMed:12564925, ECO:0000269\|PubMed:16091359, Experimental EvidencePubMed:24648509}. Cytoplasm {Experimental EvidencePubMed:22052202}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:22052202, Experimental EvidencePubMed:26745724}. Note=Localizes to the perinuclear region in the presence of RELT (PubMed:22052202). Palmitoylation regulates its localization to the cell membrane or the nucleus; trafficking to the cell membrane is dependent upon palmitoylation whereas in the absence of palmitoylation, localizes to the nucleus (PubMed:12564925). {Experimental EvidencePubMed:12564925, Experimental EvidencePubMed:22052202}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Experimental Evidence {ECO:0000269\|PubMed:23590222}
Assigned Ontology terms

Cellular Component	Collagen-Containing Extracellular Matrix (GO:0062023) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Extracellular Exosome (GO:0070062) Golgi Apparatus (GO:0005794) Membrane (GO:0016020) Membrane Raft (GO:0045121) Nucleolus (GO:0005730) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886)

Biology & Function

Description
Catalyzes calcium-induced ATP-independent rapid bidirectional and non-specific movement of phospholipids (lipid scrambling or lipid flip-flop) between the inner and outer leaflet of the plasma membrane resulting in collapse of the phospholipid asymmetry which leads to phosphatidylserine externalization on the cell surface (PubMed:9218461, PubMed:8663431, PubMed:10770950, PubMed:9572851, PubMed:9485382, PubMed:18629440, PubMed:23590222, PubMed:24648509, PubMed:24343571, PubMed:32110987, PubMed:23659204, PubMed:29748552). Mediates calcium- dependent phosphatidylserine externalization and apoptosis in neurons via its association with TRPC5 (By similarity). Also exhibits magnesium-dependent nuclease activity against double-stranded DNA and RNA but not single-stranded DNA and can enhance DNA decatenation mediated by TOP2A (PubMed:27206388, PubMed:17567603). Negatively regulates FcR-mediated phagocytosis in differentiated macrophages (PubMed:26745724). May contribute to cytokine-regulated cell proliferation and differentiation (By similarity). May play a role in the antiviral response of interferon (IFN) by amplifying and enhancing the IFN response through increased expression of select subset of potent antiviral genes (PubMed:15308695). Acts as an attachment receptor for HCV (PubMed:21806988). {By SimilarityUniProtKB:Q9JJ00, Experimental EvidencePubMed:10770950, Experimental EvidencePubMed:15308695, Experimental EvidencePubMed:17567603, Experimental EvidencePubMed:18629440, Experimental EvidencePubMed:21806988, Experimental EvidencePubMed:23590222, Experimental EvidencePubMed:23659204, Experimental EvidencePubMed:24343571, Experimental EvidencePubMed:24648509, Experimental EvidencePubMed:26745724, Experimental EvidencePubMed:27206388, Experimental EvidencePubMed:29748552, Experimental EvidencePubMed:32110987, Experimental EvidencePubMed:8663431, Experimental EvidencePubMed:9218461, Experimental EvidencePubMed:9485382, Experimental EvidencePubMed:9572851}.
Assigned Ontology terms

Biological Process	Acute-Phase Response (GO:0006953) Apoptotic Process (GO:0006915) Defense Response To Virus (GO:0051607) Negative Regulation Of Phagocytosis (GO:0050765) Negative Regulation Of Viral Genome Replication (GO:0045071) Phosphatidylserine Biosynthetic Process (GO:0006659) Phosphatidylserine Exposure On Apoptotic Cell Surface (GO:0070782) Plasma Membrane Phospholipid Scrambling (GO:0017121) Platelet Activation (GO:0030168) Positive Regulation Of Chromosome Separation (GO:1905820) Positive Regulation Of DNA Topoisomerase (ATP-Hydrolyzing) Activity (GO:2000373) Positive Regulation Of Gene Expression (GO:0010628) Positive Regulation Of Innate Immune Response (GO:0045089) Positive Regulation Of Transcription By RNA Polymerase II (GO:0045944) Regulation Of Fc Receptor Mediated Stimulatory Signaling Pathway (GO:0060368) Regulation Of Mast Cell Activation (GO:0033003) Response To Interferon-Beta (GO:0035456) Response To Lead Ion (GO:0010288)
Molecular Function	Calcium Ion Binding (GO:0005509) CD4 Receptor Binding (GO:0042609) DNA Binding (GO:0003677) DNA-Binding Transcription Activator Activity, RNA Polymerase II-Specific (GO:0001228) Enzyme Binding (GO:0019899) Epidermal Growth Factor Receptor Binding (GO:0005154) Lead Ion Binding (GO:0032791) Magnesium Ion Binding (GO:0000287) Mercury Ion Binding (GO:0045340) Nuclease Activity (GO:0004518) Phospholipid Scramblase Activity (GO:0017128) SH3 Domain Binding (GO:0017124) Virus Receptor Activity (GO:0001618) Zinc Ion Binding (GO:0008270)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (12 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q9Y272	Dexamethasone-induced Ras-related protein 1	EBI-752746	0.37
Q9WMX2	RNA-directed RNA polymerase	EBI-7048894	0.58
O75716	Serine/threonine-protein kinase 16	EBI-10189073	0.56
P01112	GTPase HRas, N-terminally processed	EBI-27045317	0.27
P50995	Annexin A11	EBI-752707	0.55
P54259	Atrophin-1	EBI-956422	0.00
Q96S66	Chloride channel CLIC-like protein 1	EBI-21724762	0.35
Q9H4E7	Differentially expressed in FDCP 6 homolog	EBI-10306705	0.56
Q12756	Kinesin-like protein KIF1A	EBI-21249906	0.37
Q14764	Major vault protein	EBI-3933015	0.44
P0CK47	Nuclear egress protein 1	EBI-2622485	0.37
Q9BVI4	Nucleolar complex protein 4 homolog	EBI-754600	0.37
Interactions with other proteins (158 interactors)

Partner (UniProt)		IntAct	Confidence score
Q92734	Protein TFG (TRK-fused gene protein)	EBI-760686	0.51
Q16630	Cleavage and polyadenylation specificity factor subunit 6 (Cleavage and polyadenylation specificity factor 68 kDa subunit) (CPSF 68 kDa subunit) (Cleavage factor Im complex 68 kDa subunit) (CFIm68) (Pre-mRNA cleavage factor Im 68 kDa subunit) (Protein HPBRII-4/7)	EBI-760770	0.51
Q8WWR8	Sialidase-4 (EC 3.2.1.18) (N-acetyl-alpha-neuraminidase 4)	EBI-760826	0.51
Q16526	Cryptochrome-1	EBI-752884	0.55
P12236	ADP/ATP translocase 3 (ADP,ATP carrier protein 3) (ADP,ATP carrier protein, isoform T2) (ANT 2) (Adenine nucleotide translocator 3) (ANT 3) (Solute carrier family 25 member 6) [Cleaved into: ADP/ATP translocase 3, N-terminally processed]	EBI-752902	0.37
Q86UW9	Probable E3 ubiquitin-protein ligase DTX2 (EC 2.3.2.27) (Protein deltex-2) (Deltex2) (hDTX2) (RING finger protein 58) (RING-type E3 ubiquitin transferase DTX2)	EBI-752956	0.37
P49639	Homeobox protein Hox-A1 (Homeobox protein Hox-1F)	EBI-753064	0.37
Q6UY11	Protein delta homolog 2 (DLK-2) (Epidermal growth factor-like protein 9) (EGF-like protein 9)	EBI-753187	0.37
Q9UQ90	Paraplegin (EC 3.4.24.-) (Cell matrix adhesion regulator) (Spastic paraplegia 7 protein)	EBI-753205	0.37
Q14847	LIM and SH3 domain protein 1 (LASP-1) (Metastatic lymph node gene 50 protein) (MLN 50)	EBI-753385	0.37
Q9HB63	Netrin-4 (Beta-netrin) (Hepar-derived netrin-like protein)	EBI-753493	0.37
Q9GZM5	Protein YIPF3 (Killer lineage protein 1) (Natural killer cell-specific antigen KLIP1) (YIP1 family member 3) [Cleaved into: Protein YIPF3, 36 kDa form III]	EBI-753622	0.37
Q8WV24	Pleckstrin homology-like domain family A member 1 (Apoptosis-associated nuclear protein) (Proline- and glutamine-rich protein) (PQ-rich protein) (PQR protein) (Proline- and histidine-rich protein) (T-cell death-associated gene 51 protein)	EBI-753994	0.37
Q15637	Splicing factor 1 (Mammalian branch point-binding protein) (BBP) (mBBP) (Transcription factor ZFM1) (Zinc finger gene in MEN1 locus) (Zinc finger protein 162)	EBI-754123	0.37
Q8N5R6	Coiled-coil domain-containing protein 33 (Cancer/testis antigen 61) (CT61)	EBI-754207	0.37
Q9H7M9	V-type immunoglobulin domain-containing suppressor of T-cell activation (Platelet receptor Gi24) (Stress-induced secreted protein-1) (Sisp-1) (V-set domain-containing immunoregulatory receptor) (V-set immunoregulatory receptor)	EBI-754333	0.37
O95967	EGF-containing fibulin-like extracellular matrix protein 2 (Fibulin-4) (FIBL-4) (Protein UPH1)	EBI-754366	0.37
P04899	Guanine nucleotide-binding protein G(i) subunit alpha-2 (Adenylate cyclase-inhibiting G alpha protein)	EBI-754627	0.37
Q9H0B3	IQ domain-containing protein N	EBI-754753	0.37
Q9H0I2	Enkurin domain-containing protein 1	EBI-754936	0.37
O94817	Ubiquitin-like protein ATG12 (Autophagy-related protein 12) (APG12-like)	EBI-755323	0.37
P17509	Homeobox protein Hox-B6 (Homeobox protein Hox-2.2) (Homeobox protein Hox-2B) (Homeobox protein Hu-2)	EBI-755602	0.37
Q02218	2-oxoglutarate dehydrogenase complex component E1 (E1o) (OGDC-E1) (OGDH-E1) (EC 1.2.4.2) (2-oxoglutarate dehydrogenase, mitochondrial) (Alpha-ketoglutarate dehydrogenase) (Alpha-KGDH-E1) (Thiamine diphosphate (ThDP)-dependent 2-oxoglutarate dehydrogenase)	EBI-755686	0.37
Q96RN5	Mediator of RNA polymerase II transcription subunit 15 (Activator-recruited cofactor 105 kDa component) (ARC105) (CTG repeat protein 7a) (Mediator complex subunit 15) (Positive cofactor 2 glutamine/Q-rich-associated protein) (PC2 glutamine/Q-rich-associated protein) (TPA-inducible gene 1 protein) (TIG-1) (Trinucleotide repeat-containing gene 7 protein)	EBI-755719	0.37
Q9UHH9	Inositol hexakisphosphate kinase 2 (InsP6 kinase 2) (InsP6K2) (EC 2.7.4.-) (P(i)-uptake stimulator) (PiUS)	EBI-755854	0.37
Q96D16	FBXL18 protein	EBI-756055	0.37
Q9NVZ3	Adaptin ear-binding coat-associated protein 2 (NECAP endocytosis-associated protein 2) (NECAP-2)	EBI-756250	0.37
Q9NTK1	Protein DEPP1 (Decidual protein induced by progesterone) (Fasting-induced gene protein) (FIG)	EBI-756334	0.37
Q9BTL3	RNA guanine-N7 methyltransferase activating subunit (Protein FAM103A1) (RNA guanine-7 methyltransferase activating subunit) (RNMT-activating mRNA cap methyltransferase subunit) (RNMT-activating mini protein) (RAM)	EBI-756349	0.37
Q9NRQ2	Phospholipid scramblase 4 (PL scramblase 4) (Ca(2+)-dependent phospholipid scramblase 4) (Cell growth-inhibiting gene 43 protein) (TRA1)	EBI-756400	0.55
Q5TA45	Integrator complex subunit 11 (Int11) (EC 3.1.27.-) (Cleavage and polyadenylation-specific factor 3-like protein) (CPSF3-like protein) (Protein related to CPSF subunits of 68 kDa) (RC-68)	EBI-756403	0.37
P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	EBI-756454	0.37
Q9H1Q7	PC-esterase domain-containing protein 1A (Protein FAM113A) (Sarcoma antigen NY-SAR-23)	EBI-756592	0.37
Q9BQ66	Keratin-associated protein 4-12 (Keratin-associated protein 4.12) (Ultrahigh sulfur keratin-associated protein 4.12)	EBI-756703	0.37
O60269	G protein-regulated inducer of neurite outgrowth 2 (GRIN2)	EBI-756826	0.37
O43597	Protein sprouty homolog 2 (Spry-2)	EBI-757330	0.37
P50552	Vasodilator-stimulated phosphoprotein (VASP)	EBI-757717	0.37
Q00587	Cdc42 effector protein 1 (Binder of Rho GTPases 5) (Serum protein MSE55)	EBI-757975	0.37
Q9P0T4	Zinc finger protein 581	EBI-758233	0.37
P31269	Homeobox protein Hox-A9 (Homeobox protein Hox-1G)	EBI-758332	0.37
Q9UBP5	Hairy/enhancer-of-split related with YRPW motif protein 2 (Cardiovascular helix-loop-helix factor 1) (hCHF1) (Class B basic helix-loop-helix protein 32) (bHLHb32) (HES-related repressor protein 2) (Hairy and enhancer of split-related protein 2) (HESR-2) (Hairy-related transcription factor 2) (HRT-2) (hHRT2) (Protein gridlock homolog)	EBI-758455	0.37
Q9NRY6	Phospholipid scramblase 3 (PL scramblase 3) (Ca(2+)-dependent phospholipid scramblase 3)	EBI-758575	0.37
Q6UY14	ADAMTS-like protein 4 (ADAMTSL-4) (Thrombospondin repeat-containing protein 1)	EBI-758659	0.37
Q9NXX0	ILF3 protein (cDNA FLJ20011 fis, clone ADKA03432) (cDNA: FLJ22168 fis, clone HRC00618)	EBI-758836	0.67
Q9NQX5	Neural proliferation differentiation and control protein 1 (NPDC-1)	EBI-758863	0.37
Q8TC90	Coiled-coil domain-containing glutamate-rich protein 1	EBI-759061	0.55
Q96H86	Zinc finger protein 764	EBI-759202	0.37
Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	EBI-759382	0.67
Q8N9H8	Exonuclease mut-7 homolog (EC 3.1.-.-) (Exonuclease 3'-5' domain-containing protein 3)	EBI-759559	0.37
P26992	Ciliary neurotrophic factor receptor subunit alpha (CNTF receptor subunit alpha) (CNTFR-alpha)	EBI-759679	0.37
P49901	Sperm mitochondrial-associated cysteine-rich protein	EBI-759850	0.37
O76003	Glutaredoxin-3 (PKC-interacting cousin of thioredoxin) (PICOT) (PKC-theta-interacting protein) (PKCq-interacting protein) (Thioredoxin-like protein 2)	EBI-759904	0.67
Q96LJ7	Dehydrogenase/reductase SDR family member 1 (EC 1.1.1.-) (Short chain dehydrogenase/reductase family 19C member 1) (Protein SDR19C1)	EBI-759907	0.37
Q15038	DAZ-associated protein 2 (Deleted in azoospermia-associated protein 2) (Proline-rich transcript in brain protein)	EBI-759946	0.67
Q14966	Zinc finger protein 638 (Cutaneous T-cell lymphoma-associated antigen se33-1) (CTCL-associated antigen se33-1) (Nuclear protein 220) (Zinc finger matrin-like protein)	EBI-759949	0.37
P78381	UDP-galactose translocator (Solute carrier family 35 member A2) (UDP-galactose transporter) (UDP-Gal-Tr) (UGT)	EBI-759955	0.55
Q05516	Zinc finger and BTB domain-containing protein 16 (Promyelocytic leukemia zinc finger protein) (Zinc finger protein 145) (Zinc finger protein PLZF)	EBI-759961	0.37
Q96CW7	C4orf42 protein (HCG1818415)	EBI-760078	0.37
Q5T681	Uncharacterized protein C10orf62	EBI-760102	0.37
Q9P2R6	Arginine-glutamic acid dipeptide repeats protein (Atrophin-1-like protein) (Atrophin-1-related protein)	EBI-956766	0.00
P0C722	Transcriptional activator BRRF1	EBI-2623040	0.37
P46109	Crk-like protein	EBI-2652697	0.00
Q5NI93	Cell division protein FtsZ	EBI-2797189	0.00
Q5NGT6	FUSC family protein	EBI-2797199	0.00
Q5NHR7	Glutamate dehydrogenase	EBI-2798447	0.00
Q5NGM7	Guanosine-3',5'-bis(diphosphate) 3'-diphosphatase (EC 3.1.7.2)	EBI-2798462	0.00
Q5NEB5	Protein-L-isoaspartate O-methyltransferase (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase)	EBI-2803594	0.00
Q5NFA1	Sulfate permease family protein	EBI-2803587	0.00
A0A6L8PQR4	Glycosyl hydrolase family protein	EBI-2811640	0.00
Q6KMS8	Elongation factor P (EF-P)	EBI-2812684	0.00
A0A6L7HFG1	DUF3967 domain-containing protein	EBI-2815730	0.00
Q81WR4	DNA mismatch repair protein MutL	EBI-2827454	0.00
A0A6L7H5N1	Conserved repeat domain protein	EBI-2827487	0.00
A0A6L7HFV2	Putative prophage LambdaBa01, terminase, large subunit	EBI-2827473	0.00
A0A6L7HHZ0	Beta-lactam antibiotic acylase family protein	EBI-2827494	0.00
A0A6H3AF39	Histidine kinase (EC 2.7.13.3)	EBI-2827480	0.00
A0A6L8PQV1	Spore coat protein	EBI-2827466	0.00
A0A2P0HLN8	Stage 0 sporulation protein J	EBI-2827520	0.00
A0A348A6M1	LPXTG-motif cell wall anchor domain protein	EBI-2827501	0.00
A0A6L8PXB2	Putative membrane protein	EBI-2827513	0.00
Q8D162	Protein-export membrane protein SecF	EBI-2846005	0.00
Q8D1M8	VgrG-like protein	EBI-2845998	0.00
Q8CZX8	Positive regulator for lys	EBI-2846017	0.00
Q7ARD3	Transcriptional regulator	EBI-2861159	0.00
Q7CGI0	Cell division protein FtsP	EBI-2861152	0.00
Q8CZQ9	Exu regulon transcriptional regulator (Negative regulator of exu regulon, exuT, uxaAC, and uxuB)	EBI-2861145	0.00
P51828	Adenylate cyclase type 7 (EC 4.6.1.1) (ATP pyrophosphate-lyase 7) (Adenylate cyclase type VII) (Adenylyl cyclase 7)	EBI-3926300	0.37
Q09472	Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-)	EBI-3929145	0.37
P23142	Fibulin-1 (FIBL-1)	EBI-3929501	0.37
P04196	Histidine-rich glycoprotein (Histidine-proline-rich glycoprotein) (HPRG)	EBI-3930936	0.44
P29590	Protein PML (E3 SUMO-protein ligase PML) (EC 2.3.2.-) (Promyelocytic leukemia protein) (RING finger protein 71) (RING-type E3 SUMO transferase PML) (Tripartite motif-containing protein 19) (TRIM19)	EBI-3932985	0.44
Q15466	Nuclear receptor subfamily 0 group B member 2 (Orphan nuclear receptor SHP) (Small heterodimer partner)	EBI-3933005	0.44
P28749	Retinoblastoma-like protein 1 (107 kDa retinoblastoma-associated protein) (p107) (pRb1)	EBI-3932995	0.37
Q92837	Proto-oncogene FRAT1 (Frequently rearranged in advanced T-cell lymphomas 1) (FRAT-1)	EBI-3934906	0.37
P09022	Homeobox protein Hox-A1 (Early retinoic acid 1) (Homeobox protein Hox-1.6) (Homeoboxless protein ERA-1-399) (Homeotic protein ERA-1-993)	EBI-3957769	0.57
Q16625	Occludin	EBI-7049161	0.40
Q16659	Mitogen-activated protein kinase 6 (MAP kinase 6) (MAPK 6) (EC 2.7.11.24) (Extracellular signal-regulated kinase 3) (ERK-3) (MAP kinase isoform p97) (p97-MAPK)	EBI-7214663	0.37
P04578	Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]	EBI-6174459	0.35
A5D8V6	Vacuolar protein sorting-associated protein 37C (hVps37C) (ESCRT-I complex subunit VPS37C)	EBI-10173568	0.56
A8KA13	B-cell CLL/lymphoma 6, member B (Zinc finger protein), isoform CRA_a (cDNA FLJ16548 fis, clone PLACE7000410, highly similar to B-cell CLL/lymphoma 6 member B protein) (cDNA FLJ77637) (cDNA FLJ77701, highly similar to Homo sapiens B-cell CLL/lymphoma 6, member B (zinc finger protein)(BCL6B), mRNA)	EBI-10174837	0.56
O43559	Fibroblast growth factor receptor substrate 3 (FGFR substrate 3) (FGFR-signaling adaptor SNT2) (Suc1-associated neurotrophic factor target 2) (SNT-2)	EBI-10184229	0.56
P49796	Regulator of G-protein signaling 3 (RGP3) (RGS3)	EBI-10211533	0.56
P60411	Keratin-associated protein 10-9 (High sulfur keratin-associated protein 10.9) (Keratin-associated protein 10.9) (Keratin-associated protein 18-9) (Keratin-associated protein 18.9)	EBI-10217269	0.56
P60412	Keratin-associated protein 10-11 (High sulfur keratin-associated protein 10.11) (Keratin-associated protein 10.11) (Keratin-associated protein 18-11) (Keratin-associated protein 18.11)	EBI-10217496	0.56
Q13563	Polycystin-2 (PC2) (Autosomal dominant polycystic kidney disease type II protein) (Polycystic kidney disease 2 protein) (Polycystwin) (R48321) (Transient receptor potential cation channel subfamily P member 2)	EBI-10230119	0.56
Q15077	P2Y purinoceptor 6 (P2Y6)	EBI-10235792	0.56
Q5T5A8	Late cornified envelope protein 3C (Late envelope protein 15) (Small proline-rich-like epidermal differentiation complex protein 3A)	EBI-10245304	0.49
Q5TA78	Late cornified envelope protein 4A (Late envelope protein 8) (Small proline-rich-like epidermal differentiation complex protein 4A)	EBI-10246371	0.56
Q5TA82	Late cornified envelope protein 2D (Late envelope protein 12) (Small proline-rich-like epidermal differentiation complex protein 1A)	EBI-10246765	0.56
Q6DKI2	Galectin-9C (Gal-9C) (Galectin-9-like protein B)	EBI-10249446	0.56
Q6L8G9	Keratin-associated protein 5-6 (Keratin-associated protein 5.6) (Ultrahigh sulfur keratin-associated protein 5.6)	EBI-10250607	0.56
Q6RVD6	Spermatogenesis-associated protein 8 (Spermatogenesis-related protein 8)	EBI-10254257	0.56
Q8IWZ5	Tripartite motif-containing protein 42	EBI-10262279	0.56
Q8NEC5	Cation channel sperm-associated protein 1 (CatSper1) (hCatSper)	EBI-10270454	0.56
Q8TAU3	Zinc finger protein 417	EBI-10272105	0.56
Q92608	Dedicator of cytokinesis protein 2	EBI-10278739	0.56
Q92731	Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)	EBI-10279178	0.67
Q92922	SWI/SNF complex subunit SMARCC1 (BRG1-associated factor 155) (BAF155) (SWI/SNF complex 155 kDa subunit) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1)	EBI-10279735	0.56
Q96SQ5	Zinc finger protein 587	EBI-10293486	0.56
Q9BWG6	Sodium channel modifier 1	EBI-10300516	0.67
Q9BYQ4	Keratin-associated protein 9-2 (Keratin-associated protein 9.2) (Ultrahigh sulfur keratin-associated protein 9.2)	EBI-10302096	0.56
Q9BYQ6	Keratin-associated protein 4-11 (Keratin-associated protein 4-14) (Keratin-associated protein 4.11) (Keratin-associated protein 4.14) (Ultrahigh sulfur keratin-associated protein 4.14)	EBI-10302425	0.56
Q9BYR5	Keratin-associated protein 4-2 (Keratin-associated protein 4.2) (Ultrahigh sulfur keratin-associated protein 4.2)	EBI-10302754	0.56
Q9H2X0	Chordin	EBI-10306163	0.56
Q9HBR3	GDPD5 protein	EBI-10310204	0.56
Q9NQL9	Doublesex- and mab-3-related transcription factor 3	EBI-10312022	0.56
Q9NZ81	Proline-rich protein 13 (Taxane-resistance protein)	EBI-10316901	0.56
Q9UBR2	Cathepsin Z (EC 3.4.18.1) (Cathepsin P) (Cathepsin X)	EBI-10319318	0.56
Q9HBZ2	Aryl hydrocarbon receptor nuclear translocator 2 (ARNT protein 2) (Class E basic helix-loop-helix protein 1) (bHLHe1)	EBI-21247269	0.37
X5DP31	Aryl-hydrocarbon receptor nuclear translocator 2 isoform E	EBI-21247635	0.37
X5D7R7	Major vault protein isoform G	EBI-21250449	0.37
P78337	Pituitary homeobox 1 (Hindlimb-expressed homeobox protein backfoot) (Homeobox protein PITX1) (Paired-like homeodomain transcription factor 1)	EBI-21251600	0.37
P15625	Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS)	EBI-11523414	0.56
Q12329	Heat shock protein 42 (42 kDa heat shock protein)	EBI-11537219	0.56
A0A0S2Z5X4	Zinc finger protein 688 isoform 4	EBI-16429025	0.56
Q16799	Reticulon-1 (Neuroendocrine-specific protein)	EBI-21515832	0.35
Q9UBU6	Protein FAM8A1 (Autosomal highly conserved protein)	EBI-21677026	0.35
Q00765	Receptor expression-enhancing protein 5 (Polyposis locus protein 1) (Protein TB2)	EBI-21723128	0.35
Q86VR2	Reticulophagy regulator 3	EBI-21724593	0.35
B7Z3K1	cDNA FLJ51973	EBI-21724478	0.35
Q9H902	Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)	EBI-21724908	0.35
Q9Y3E2	BolA-like protein 1 (hBolA)	EBI-21724951	0.35
Q9H741	SREBP regulating gene protein (SREBF pathway regulator in Golgi 1)	EBI-21724817	0.35
P61417	Chaperone protein YscY (Yop proteins translocation protein Y)	EBI-20592260	0.51
Q56973	Chaperone protein YscB (Yop proteins translocation protein B)	EBI-20592286	0.51
P69974	Yop proteins translocation protein K (Low calcium response locus protein KB)	EBI-20592294	0.51
Q8ZG77	Outer membrane protein A (Outer membrane porin A)	EBI-20592328	0.51
Q7ARI8	Type 3 secretion system ATPase (T3SS ATPase) (EC 7.4.2.8)	EBI-20817460	0.37
A0A0H2VZS6	Reverse transcriptase domain-containing protein	EBI-20817960	0.37
O84569	Inner membrane protein	EBI-22303917	0.35
P05067	Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31]	EBI-25936136	0.56
Q7Z417	FMR1-interacting protein NUFIP2 (82 kDa FMRP-interacting protein) (82-FIP) (Cell proliferation-inducing gene 1 protein) (FMRP-interacting protein 2) (Nuclear FMR1-interacting protein 2)	EBI-26508567	0.51
P34972	Cannabinoid receptor 2 (CB-2) (CB2) (hCB2) (CX5)	EBI-26880846	0.35
P01116	GTPase KRas (EC 3.6.5.2) (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed]	EBI-27041844	0.27
P01111	GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras)	EBI-27042293	0.27
F1PAA9	Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3]	EBI-27079701	0.27
P46934	E3 ubiquitin-protein ligase NEDD4 (EC 2.3.2.26) (Cell proliferation-inducing gene 53 protein) (HECT-type E3 ubiquitin transferase NEDD4) (Neural precursor cell expressed developmentally down-regulated protein 4) (NEDD-4)	EBI-30831962	0.44
P46937	Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog)	EBI-30845911	0.44

Cross-References

Database	Links
UNIPROT	O15162 B2R8H8 B4DTE8
PDB	1Y2A
Pfam	PF03803
OMIM	604170
DisGeNET	5359

Phospholipid scramblase 1 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 1Y2A)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (12 interactors)

Interactions with other proteins (158 interactors)

Cross-References

Database

Links

Description

Description