NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Nuclear pore glycoprotein p62 - Rattus norvegicus - NucEnvDB

Nuclear pore glycoprotein p62 (Rattus norvegicus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Nuclear pore glycoprotein p62
Accession Code	P17955
Gene	Nup62
Organism	Rattus norvegicus \| Norway rat (Taxonomy: 10116)
Part of Reference Proteome?	Yes
Sequence (Length: 525)
MSGFNFGGTGAPAGGFTFGTAKTATTTPATGFSFSASGTGTGGFNFGTPSQPAATTPSTSLFSLATQTSTTQTPGFNFGT TPASGGTGFSLGISTPKLSLSSTAATPATANTGSFGLGSSTLTNAISGASTSSQGTAPTGFVFGSSTTSAPSTGTTGFSF TSGSASQPGASGFNIGSVGSLAQPTALSGSPFTPATLATTTAGATQPAAATPTAATTSAGSTLFASIAAAPASSSTTVLS LSAPATTAATPTAGTLGFSLKAPGAAPGASTTSTTTTTTTTTTTASTSSSTTTTGFALSLKPLVPAGPSSVAATALPASS TAVGTTTGPAMTYAQLESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFIL SQQKELEDLLSPLEESVKEQSGTIYLQHADEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNMAGGPADTSDPLQQICKI LNAHMDSLQWVDQSSALLQRRVEEASRVCESRRKEQERSLRIAFD

Structure Viewer (PDB: 5H1X)

Subcellular Location

Description
Nucleus, nuclear pore complex {Experimental EvidencePubMed:8707840}. Cytoplasm, cytoskeleton, spindle pole {By SimilarityUniProtKB:P37198}. Nucleus envelope {Experimental EvidencePubMed:2190987}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {By SimilarityUniProtKB:P37198}. Note=Central region of the nuclear pore, within the transporter. During mitotic cell division, it associates with the poles of the mitotic spindle. {By SimilarityUniProtKB:P37198}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Pore Complex	SL-0185	The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs).
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Annulate Lamellae (GO:0005642) Centrosome (GO:0005813) Cytoplasm (GO:0005737) Flemming Body (GO:0090543) Mitotic Spindle (GO:0072686) Nuclear Envelope (GO:0005635) Nuclear Membrane (GO:0031965) Nuclear Pore (GO:0005643) Nuclear Pore Central Transport Channel (GO:0044613) Protein-Containing Complex (GO:0032991) Ribonucleoprotein Complex (GO:1990904) Spindle Pole (GO:0000922)

Biology & Function

Description
Essential component of the nuclear pore complex (PubMed:2190987, PubMed:8707840). The N-terminal is probably involved in nucleocytoplasmic transport (By similarity). The C-terminal is involved in protein-protein interaction probably via coiled-coil formation, promotes its association with centrosomes and may function in anchorage of p62 to the pore complex (By similarity). Plays a role in mitotic cell cycle progression by regulating centrosome segregation, centriole maturation and spindle orientation (By similarity). It might be involved in protein recruitment to the centrosome after nuclear breakdown (By similarity). {By SimilarityUniProtKB:P37198, Experimental EvidencePubMed:2190987, Experimental EvidencePubMed:8707840}.
Assigned Ontology terms

Biological Process	Cell Death (GO:0008219) Cell Surface Receptor Signaling Pathway (GO:0007166) Cellular Senescence (GO:0090398) Centriole Assembly (GO:0098534) Centrosome Cycle (GO:0007098) Mitotic Cell Cycle (GO:0000278) Mitotic Centrosome Separation (GO:0007100) Mitotic Metaphase Plate Congression (GO:0007080) MRNA Transport (GO:0051028) Negative Regulation Of Apoptotic Process (GO:0043066) Negative Regulation Of Cell Population Proliferation (GO:0008285) Negative Regulation Of Epidermal Growth Factor Receptor Signaling Pathway (GO:0042059) Negative Regulation Of MAP Kinase Activity (GO:0043407) Negative Regulation Of Programmed Cell Death (GO:0043069) Negative Regulation Of Ras Protein Signal Transduction (GO:0046580) Positive Regulation Of Centriole Replication (GO:0046601) Positive Regulation Of DNA-Templated Transcription (GO:0045893) Positive Regulation Of I-KappaB Kinase/NF-KappaB Signaling (GO:0043123) Positive Regulation Of Mitotic Cytokinetic Process (GO:1903438) Positive Regulation Of Mitotic Nuclear Division (GO:0045840) Positive Regulation Of Protein Localization To Centrosome (GO:1904781) Protein Import Into Nucleus (GO:0006606) Regulation Of Mitotic Spindle Organization (GO:0060236) Regulation Of Protein Import Into Nucleus (GO:0042306) RNA Export From Nucleus (GO:0006405) Spermatogenesis (GO:0007283)
Molecular Function	Hsp70 Protein Binding (GO:0030544) Hsp90 Protein Binding (GO:0051879) Kinesin Binding (GO:0019894) Nuclear Thyroid Hormone Receptor Binding (GO:0046966) Phospholipid Binding (GO:0005543) Protein-Containing Complex Binding (GO:0044877) PTB Domain Binding (GO:0051425) SH2 Domain Binding (GO:0042169) Signaling Receptor Complex Adaptor Activity (GO:0030159) Structural Constituent Of Nuclear Pore (GO:0017056) Ubiquitin Binding (GO:0043130)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P70168	Importin subunit beta-1	EBI-15732706	0.36

Cross-References

Database	Links
UNIPROT	P17955 A2VCW0
PDB	3T97 5H1X
Pfam	PF05064

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK