Protein Information |
|
---|---|
Protein Name | Solute carrier family 2, facilitated glucose transporter member 4 |
Accession Code | P19357 |
Gene | Slc2a4 |
Organism | Rattus norvegicus | Norway rat (Taxonomy: 10116) |
Part of Reference Proteome? | Yes |
Sequence (Length: 509) | |
MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNATWLGRQGPGGPDSIPQGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLANNVLAVLGGALMGLAN AAASYEILILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILVAQVLGLESMLGTATLWPLLLAITVLPALLQLLLLPFCPESPRYLYIIRNLEGPARKSLKRLTGWADVSDALAEL KDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFELAGVEQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVALLLLERVPSMSYVSIVAIFG FVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTCNFIVGMGFQYVADAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQISATFRRTPSLLEQEVKPSTELEYLGPDEND |
Description |
|
---|---|
Note=It is a candidate for certain post-receptor defects in non-insulin-dependent diabetes mellitus. | Database Associations |
OMIM | |
DisGeNET |
Interactions with Nuclear Envelope proteins (20 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
O54861 | Sortilin | EBI-921030 | 0.35 |
P10536 | Ras-related protein Rab-1B | EBI-921030 | 0.35 |
P63245 | Receptor of activated protein C kinase 1, N-terminally processed | EBI-921030 | 0.35 |
P70470 | Acyl-protein thioesterase 1 | EBI-921030 | 0.35 |
P62828 | GTP-binding nuclear protein Ran | EBI-921030 | 0.35 |
Q9JI85 | Nesfatin-1 | EBI-921030 | 0.35 |
Q9JHB5 | Translin-associated protein X | EBI-921030 | 0.35 |
Q9Z1W6 | Protein LYRIC | EBI-921030 | 0.35 |
Q5XIP9 | Transmembrane protein 43 | EBI-921030 | 0.35 |
Q5XIU9 | Membrane-associated progesterone receptor component 2 | EBI-921030 | 0.35 |
P60192 | SNARE-associated protein Snapin | EBI-921030 | 0.35 |
P60123 | RuvB-like 1 | EBI-921030 | 0.35 |
P52296 | Importin subunit beta-1 | EBI-921030 | 0.35 |
P48679 | Lamin-A/C | EBI-921030 | 0.35 |
P63004 | Platelet-activating factor acetylhydrolase IB subunit alpha | EBI-921030 | 0.35 |
P36202 | PDZ and LIM domain protein 4 | EBI-921030 | 0.35 |
P35281 | Ras-related protein Rab-10 | EBI-921030 | 0.35 |
Q9QXQ0 | Alpha-actinin-4 | EBI-921030 | 0.54 |
P61206 | ADP-ribosylation factor 3 | EBI-921030 | 0.35 |
P84083 | ADP-ribosylation factor 5 | EBI-921030 | 0.35 | Interactions with other proteins (614 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
Q3L7M0 | N-acetyllactosaminide alpha-1,3-galactosyltransferase (EC 2.4.1.87) (UDP-galactose:beta-D-galactosyl-1,4-N-acetyl-D-glucosaminide alpha-1,3-galactosyltransferase) (Galactosyltransferase) | EBI-921030 | 0.35 |
P34067 | Proteasome subunit beta type-4 (Macropain beta chain) (Multicatalytic endopeptidase complex beta chain) (Proteasome beta chain) (Proteasome chain 3) (RN3) | EBI-921030 | 0.35 |
Q794F9 | 4F2 cell-surface antigen heavy chain (4F2hc) (Solute carrier family 3 member 2) (CD antigen CD98) | EBI-921030 | 0.35 |
O70351 | 3-hydroxyacyl-CoA dehydrogenase type-2 (EC 1.1.1.35) (17-beta-estradiol 17-dehydrogenase) (EC 1.1.1.62) (2-methyl-3-hydroxybutyryl-CoA dehydrogenase) (MHBD) (3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+))) (EC 1.1.1.239) (3-hydroxy-2-methylbutyryl-CoA dehydrogenase) (EC 1.1.1.178) (3-hydroxyacyl-CoA dehydrogenase type II) (3alpha(or 20beta)-hydroxysteroid dehydrogenase) (EC 1.1.1.53) (7-alpha-hydroxysteroid dehydrogenase) (EC 1.1.1.159) (Endoplasmic reticulum-associated amyloid beta-peptide-binding protein) (Mitochondrial ribonuclease P protein 2) (Mitochondrial RNase P protein 2) (Short chain dehydrogenase/reductase family 5C member 1) (Short-chain type dehydrogenase/reductase XH98G2) (Type II HADH) | EBI-921030 | 0.35 |
P62246 | 40S ribosomal protein S15a | EBI-921030 | 0.35 |
Q9Z1A6 | Vigilin (High density lipoprotein-binding protein) (HDL-binding protein) | EBI-921030 | 0.35 |
O55012 | Phosphatidylinositol-binding clathrin assembly protein (Clathrin assembly lymphoid myeloid leukemia protein) (rCALM) | EBI-921030 | 0.35 |
Q5I0E7 | Transmembrane emp24 domain-containing protein 9 (p24 family protein alpha-2) (p24alpha2) | EBI-921030 | 0.35 |
Q64428 | Trifunctional enzyme subunit alpha, mitochondrial (Monolysocardiolipin acyltransferase) (EC 2.3.1.-) (TP-alpha) [Includes: Long-chain enoyl-CoA hydratase (EC 4.2.1.17); Long chain 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.211)] | EBI-921030 | 0.35 |
Q63524 | Transmembrane emp24 domain-containing protein 2 (COPI-coated vesicle membrane protein p24) (Membrane protein p24A) (RNP21.4) (p24 family protein beta-1) (p24beta1) | EBI-921030 | 0.35 |
Q2PS20 | Junctophilin-2 (JP-2) (Junctophilin type 2) [Cleaved into: Junctophilin-2 N-terminal fragment (JP2NT)] | EBI-921030 | 0.35 |
O70257 | Syntaxin-7 | EBI-921030 | 0.35 |
Q5XIA1 | Nicalin (Nicastrin-like protein) | EBI-921030 | 0.35 |
P97700 | Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP) (alpha-oxoglutarate carrier) (Solute carrier family 25 member 11) (SLC25A11) | EBI-921030 | 0.35 |
Q6NX65 | Programmed cell death protein 10 | EBI-921030 | 0.35 |
Q8R490 | Cadherin-13 | EBI-921030 | 0.35 |
P13264 | Glutaminase kidney isoform, mitochondrial (GLS) (EC 3.5.1.2) (K-glutaminase) (L-glutamine amidohydrolase) [Cleaved into: Glutaminase kidney isoform, mitochondrial 68 kDa chain; Glutaminase kidney isoform, mitochondrial 65 kDa chain] | EBI-921030 | 0.35 |
Q8R3Z7 | EH-domain-containing 4 (Pincher) | EBI-921030 | 0.35 |
Q9JJM9 | Septin-5 (Cell division control-related protein 1) (CDCrel-1) (Peanut-like protein 1) | EBI-921030 | 0.35 |
Q4QRB4 | Tubulin beta-3 chain (Neuron-specific class III beta-tubulin) | EBI-921030 | 0.35 |
Q8K3W5 | Myotubularin-related protein | EBI-921030 | 0.35 |
P12368 | cAMP-dependent protein kinase type II-alpha regulatory subunit | EBI-921030 | 0.35 |
Q4QQW8 | Putative phospholipase B-like 2 (EC 3.1.1.-) (LAMA-like protein 2) (Lamina ancestor homolog 2) (Phospholipase B domain-containing protein 2) | EBI-921030 | 0.35 |
P21263 | Nestin | EBI-921030 | 0.35 |
Q8CGU6 | Nicastrin | EBI-921030 | 0.35 |
Q8VI04 | Isoaspartyl peptidase/L-asparaginase (EC 3.4.19.5) (EC 3.5.1.1) (Asparaginase-like protein 1) (Asparaginase-like sperm autoantigen) (Beta-aspartyl-peptidase) (Glial asparaginase) (Isoaspartyl dipeptidase) (L-asparagine amidohydrolase) [Cleaved into: Isoaspartyl peptidase/L-asparaginase alpha chain; Isoaspartyl peptidase/L-asparaginase beta chain] | EBI-921030 | 0.35 |
Q812C4 | Translation initiation factor 4A, isoform 1 | EBI-921030 | 0.35 |
Q5U367 | Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 [Includes: Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 (EC 1.14.11.4) (Lysyl hydroxylase 3) (LH3); Procollagen glycosyltransferase (EC 2.4.1.50) (EC 2.4.1.66) (Galactosylhydroxylysine-glucosyltransferase) (Procollagen galactosyltransferase) (Procollagen glucosyltransferase)] | EBI-921030 | 0.35 |
Q7TSP3 | NYGGF2 | EBI-921030 | 0.35 |
Q7TPK5 | Ac2-067 | EBI-921030 | 0.35 |
Q7TPJ0 | Translocon-associated protein subunit alpha (TRAP-alpha) (Liver regeneration-related protein LRRG137) (Signal sequence receptor subunit alpha) (SSR-alpha) | EBI-921030 | 0.35 |
Q7TPB1 | T-complex protein 1 subunit delta (TCP-1-delta) (CCT-delta) | EBI-921030 | 0.35 |
Q7TP77 | 39S ribosomal protein L49, mitochondrial | EBI-921030 | 0.35 |
Q7TP72 | Aa2-050 | EBI-921030 | 0.35 |
Q7TP59 | Ab2-095 (Divergent protein kinase domain 2A) | EBI-921030 | 0.35 |
Q7TP54 | Rho family-interacting cell polarization regulator 2 | EBI-921030 | 0.35 |
Q7TP34 | Ab2-450 (Mannosidase, alpha, class 2B, member 2) | EBI-921030 | 0.35 |
Q7TP13 | Alanine transaminase (EC 2.6.1.2) | EBI-921030 | 0.35 |
Q7TP11 | 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) | EBI-921030 | 0.35 |
Q7TP08 | Alpha-methylacyl-CoA racemase (Da1-8) | EBI-921030 | 0.35 |
P26453 | Basigin (Glycoprotein CE9) (OX-47 antigen) (CD antigen CD147) | EBI-921030 | 0.35 |
Q7M0E3 | Destrin (Actin-depolymerizing factor) (ADF) | EBI-921030 | 0.35 |
Q794E4 | Heterogeneous nuclear ribonucleoprotein F (hnRNP F) [Cleaved into: Heterogeneous nuclear ribonucleoprotein F, N-terminally processed] | EBI-921030 | 0.35 |
Q792I0 | Protein lin-7 homolog C (Lin-7C) (Mammalian lin-seven protein 3) (MALS-3) (Vertebrate lin-7 homolog 3) (Veli-3) | EBI-921030 | 0.35 |
Q75NI5 | Cadherin 15 (M-cadherin) | EBI-921030 | 0.35 |
P05982 | NAD(P)H dehydrogenase [quinone] 1 (EC 1.6.5.2) (Azoreductase) (DT-diaphorase) (DTD) (Menadione reductase) (NAD(P)H:quinone oxidoreductase 1) (Phylloquinone reductase) (Quinone reductase 1) (QR1) | EBI-921030 | 0.35 |
P05765 | 40S ribosomal protein S21 | EBI-921030 | 0.35 |
P05712 | Ras-related protein Rab-2A (EC 3.6.5.2) | EBI-921030 | 0.35 |
P69897 | Tubulin beta-5 chain | EBI-921030 | 0.35 |
P68182 | cAMP-dependent protein kinase catalytic subunit beta (PKA C-beta) (EC 2.7.11.11) | EBI-921030 | 0.35 |
P68101 | Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 subunit alpha) (eIF-2-alpha) (eIF-2A) (eIF-2alpha) | EBI-921030 | 0.35 |
P05197 | Elongation factor 2 (EF-2) | EBI-921030 | 0.35 |
P05065 | Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) | EBI-921030 | 0.35 |
P04906 | Glutathione S-transferase P (EC 2.5.1.18) (Chain 7) (GST 7-7) (GST class-pi) | EBI-921030 | 0.35 |
P04897 | Guanine nucleotide-binding protein G(i) subunit alpha-2 (Adenylate cyclase-inhibiting G alpha protein) | EBI-921030 | 0.35 |
P63095 | Guanine nucleotide-binding protein G(s) subunit alpha isoforms short (Adenylate cyclase-stimulating G alpha protein) (G-alpha-8) | EBI-921030 | 0.35 |
P04797 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) (EC 1.2.1.12) (38 kDa BFA-dependent ADP-ribosylation substrate) (BARS-38) (Peptidyl-cysteine S-nitrosylase GAPDH) (EC 2.6.99.-) | EBI-921030 | 0.50 |
P04785 | Protein disulfide-isomerase (PDI) (EC 5.3.4.1) (Cellular thyroid hormone-binding protein) (Prolyl 4-hydroxylase subunit beta) | EBI-921030 | 0.35 |
P04764 | Alpha-enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Enolase 1) (Non-neural enolase) (NNE) | EBI-921030 | 0.35 |
P04762 | Catalase (EC 1.11.1.6) | EBI-921030 | 0.35 |
Q3KRE8 | Tubulin beta-2B chain (T beta-15) | EBI-921030 | 0.35 |
P62890 | 60S ribosomal protein L30 | EBI-921030 | 0.35 |
P04644 | 40S ribosomal protein S17 | EBI-921030 | 0.35 |
P04642 | L-lactate dehydrogenase A chain (LDH-A) (EC 1.1.1.27) (LDH muscle subunit) (LDH-M) | EBI-921030 | 0.35 |
P04636 | Malate dehydrogenase, mitochondrial (EC 1.1.1.37) | EBI-921030 | 0.35 |
P04466 | Myosin regulatory light chain 11 (DTNB) (Fast skeletal myosin light chain 2) (G2) (MLC-2) (Myosin light chain 11) (Myosin regulatory light chain 2, skeletal muscle isoform) | EBI-921030 | 0.35 |
P04462 | Myosin-8 (Myosin heavy chain 8) (Myosin heavy chain, skeletal muscle, perinatal) (MyHC-perinatal) | EBI-921030 | 0.35 |
P04218 | OX-2 membrane glycoprotein (MRC OX-2 antigen) (CD antigen CD200) | EBI-921030 | 0.35 |
P04182 | Ornithine aminotransferase, mitochondrial (EC 2.6.1.13) (Ornithine--oxo-acid aminotransferase) | EBI-921030 | 0.35 |
P62738 | Actin, aortic smooth muscle (EC 3.6.4.-) (Alpha-actin-2) [Cleaved into: Actin, aortic smooth muscle, intermediate form] | EBI-921030 | 0.35 |
P02600 | Myosin light chain 1/3, skeletal muscle isoform (MLC1/MLC3) (MLC1F/MLC3F) (Myosin light chain alkali 1/2) (Myosin light chain A1/A2) | EBI-921030 | 0.35 |
P63259 | Actin, cytoplasmic 2 (EC 3.6.4.-) (Gamma-actin) [Cleaved into: Actin, cytoplasmic 2, N-terminally processed] | EBI-921030 | 0.35 |
P68136 | Actin, alpha skeletal muscle (EC 3.6.4.-) (Alpha-actin-1) [Cleaved into: Actin, alpha skeletal muscle, intermediate form] | EBI-921030 | 0.35 |
P02466 | Collagen alpha-2(I) chain (Alpha-2 type I collagen) | EBI-921030 | 0.35 |
P01346 | Insulin-like growth factor II (IGF-II) (Multiplication-stimulating activity) (MSA) (Multiplication-stimulating polypeptide) [Cleaved into: Insulin-like growth factor II; Preptin] | EBI-921030 | 0.35 |
P00507 | Aspartate aminotransferase, mitochondrial (mAspAT) (EC 2.6.1.1) (EC 2.6.1.7) (Fatty acid-binding protein) (FABP-1) (Glutamate oxaloacetate transaminase 2) (Kynurenine aminotransferase 4) (Kynurenine aminotransferase IV) (Kynurenine--oxoglutarate transaminase 4) (Kynurenine--oxoglutarate transaminase IV) (Plasma membrane-associated fatty acid-binding protein) (FABPpm) (Transaminase A) | EBI-921030 | 0.35 |
O88960 | Vesicle-fusing ATPase (EC 3.6.4.6) | EBI-921030 | 0.35 |
O88941 | Mannosyl-oligosaccharide glucosidase (EC 3.2.1.106) (Glycoprotein-processing glucosidase I) | EBI-921030 | 0.35 |
O88767 | Parkinson disease protein 7 homolog (Contraception-associated protein 1) (Protein CAP1) (Fertility protein SP22) (Maillard deglycase) (Parkinsonism-associated deglycase) (Protein DJ-1) (DJ-1) (Protein/nucleic acid deglycase DJ-1) (EC 3.1.2.-, EC 3.5.1.-, EC 3.5.1.124) | EBI-921030 | 0.35 |
O88761 | 26S proteasome non-ATPase regulatory subunit 1 (26S proteasome regulatory subunit RPN2) (26S proteasome regulatory subunit S1) (26S proteasome subunit p112) | EBI-921030 | 0.35 |
O88656 | Actin-related protein 2/3 complex subunit 1B (Arp2/3 complex 41 kDa subunit) (p41-ARC) | EBI-921030 | 0.35 |
O88638 | Putative eps protein | EBI-921030 | 0.35 |
O88989 | Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) (Aromatic alpha-keto acid reductase) (KAR) (EC 1.1.1.96) (Cytosolic malate dehydrogenase) | EBI-921030 | 0.35 |
M0RC99 | Ras-related protein Rab-5A (EC 3.6.5.2) (Small GTP-binding protein rab5) | EBI-921030 | 0.35 |
G3V7P1 | Syntaxin-12 (Syntaxin-13) | EBI-921030 | 0.35 |
Q5U1Z2 | Trafficking protein particle complex subunit 3 | EBI-921030 | 0.35 |
Q52KJ9 | Thioredoxin domain containing 1 | EBI-921030 | 0.35 |
Q5BK63 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial (Complex I-39kD) (CI-39kD) (NADH-ubiquinone oxidoreductase 39 kDa subunit) (Sperm flagella protein 3) | EBI-921030 | 0.35 |
Q499V7 | Succinate-CoA ligase subunit beta (EC 6.2.1.-) | EBI-921030 | 0.35 |
Q5EBA9 | Succinate-CoA ligase subunit beta (EC 6.2.1.-) | EBI-921030 | 0.35 |
O70282 | Trehalase (EC 3.2.1.28) (Alpha-trehalose glucohydrolase) | EBI-921030 | 0.35 |
P29266 | 3-hydroxyisobutyrate dehydrogenase, mitochondrial (HIBADH) (EC 1.1.1.31) | EBI-921030 | 0.35 |
P28480 | T-complex protein 1 subunit alpha (TCP-1-alpha) (CCT-alpha) | EBI-921030 | 0.35 |
P28075 | Proteasome subunit beta type-5 (EC 3.4.25.1) (Macropain epsilon chain) (Multicatalytic endopeptidase complex epsilon chain) (Proteasome chain 6) (Proteasome epsilon chain) (Proteasome subunit X) | EBI-921030 | 0.35 |
P28042 | Single-stranded DNA-binding protein, mitochondrial (Mt-SSB) (MtSSB) (Single strand DNA-binding protein P16) | EBI-921030 | 0.35 |
P27952 | 40S ribosomal protein S2 | EBI-921030 | 0.35 |
P27881 | Hexokinase-2 (EC 2.7.1.1) (Hexokinase type II) (HK II) (Hexokinase-B) | EBI-921030 | 0.35 |
P62961 | Y-box-binding protein 1 (YB-1) (Enhancer factor I subunit A) (EFI-A) (Nuclease-sensitive element-binding protein 1) (Y-box transcription factor) | EBI-921030 | 0.35 |
P27791 | cAMP-dependent protein kinase catalytic subunit alpha (PKA C-alpha) (EC 2.7.11.11) | EBI-921030 | 0.35 |
P63086 | Mitogen-activated protein kinase 1 (MAP kinase 1) (MAPK 1) (EC 2.7.11.24) (ERT1) (Extracellular signal-regulated kinase 2) (ERK-2) (MAP kinase isoform p42) (p42-MAPK) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2) | EBI-921030 | 0.35 |
P27653 | C-1-tetrahydrofolate synthase, cytoplasmic (C1-THF synthase) [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9); Formyltetrahydrofolate synthetase (EC 6.3.4.3)] | EBI-921030 | 0.35 |
P27615 | Lysosome membrane protein 2 (85 kDa lysosomal membrane sialoglycoprotein) (LGP85) (CD36 antigen-like 2) (Lysosome membrane protein II) (LIMP II) (Scavenger receptor class B member 2) (CD antigen CD36) | EBI-921030 | 0.35 |
P27605 | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) (HGPRTase) (EC 2.4.2.8) | EBI-921030 | 0.35 |
P26772 | 10 kDa heat shock protein, mitochondrial (Hsp10) (10 kDa chaperonin) (Chaperonin 10) (CPN10) | EBI-921030 | 0.35 |
P26051 | CD44 antigen (Extracellular matrix receptor III) (ECMR-III) (GP90 lymphocyte homing/adhesion receptor) (HUTCH-I) (Hermes antigen) (Hyaluronate receptor) (Phagocytic glycoprotein 1) (PGP-1) (Phagocytic glycoprotein I) (PGP-I) (CD antigen CD44) | EBI-921030 | 0.35 |
P25235 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit) (Ribophorin II) (RPN-II) (Ribophorin-2) | EBI-921030 | 0.35 |
P62919 | 60S ribosomal protein L8 | EBI-921030 | 0.35 |
P62859 | 40S ribosomal protein S28 | EBI-921030 | 0.35 |
P62853 | 40S ribosomal protein S25 | EBI-921030 | 0.35 |
P24368 | Peptidyl-prolyl cis-trans isomerase B (PPIase B) (EC 5.2.1.8) (CYP-S1) (Cyclophilin B) (Rotamase B) (S-cyclophilin) (SCYLP) | EBI-921030 | 0.35 |
P24268 | Cathepsin D (EC 3.4.23.5) [Cleaved into: Cathepsin D 12 kDa light chain; Cathepsin D 9 kDa light chain; Cathepsin D 34 kDa heavy chain; Cathepsin D 30 kDa heavy chain] | EBI-921030 | 0.35 |
P67779 | Prohibitin 1 | EBI-921030 | 0.35 |
P24050 | 40S ribosomal protein S5 [Cleaved into: 40S ribosomal protein S5, N-terminally processed] | EBI-921030 | 0.35 |
P23965 | Enoyl-CoA delta isomerase 1, mitochondrial (MECI) (EC 5.3.3.8) (3,2-trans-enoyl-CoA isomerase) (Delta(3),Delta(2)-enoyl-CoA isomerase) (D3,D2-enoyl-CoA isomerase) (Dodecenoyl-CoA isomerase) | EBI-921030 | 0.35 |
P23928 | Alpha-crystallin B chain (Alpha(B)-crystallin) | EBI-921030 | 0.35 |
P23514 | Coatomer subunit beta (Beta-coat protein) (Beta-COP) | EBI-921030 | 0.35 |
P23358 | 60S ribosomal protein L12 | EBI-921030 | 0.35 |
P62832 | 60S ribosomal protein L23 | EBI-921030 | 0.35 |
P21708 | Mitogen-activated protein kinase 3 (MAP kinase 3) (MAPK 3) (EC 2.7.11.24) (ERT2) (Extracellular signal-regulated kinase 1) (ERK-1) (Insulin-stimulated MAP2 kinase) (MAP kinase isoform p44) (p44-MAPK) (MNK1) (Microtubule-associated protein 2 kinase) (p44-ERK1) | EBI-921030 | 0.35 |
P21670 | Proteasome subunit alpha type-4 (Macropain subunit C9) (Multicatalytic endopeptidase complex subunit C9) (Proteasome component C9) (Proteasome subunit L) | EBI-921030 | 0.35 |
P21533 | 60S ribosomal protein L6 (Neoplasm-related protein C140) | EBI-921030 | 0.35 |
P21213 | Histidine ammonia-lyase (Histidase) (EC 4.3.1.3) | EBI-921030 | 0.35 |
P20417 | Tyrosine-protein phosphatase non-receptor type 1 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1B) (PTP-1B) | EBI-921030 | 0.35 |
P63074 | Eukaryotic translation initiation factor 4E (eIF-4E) (eIF4E) (eIF-4F 25 kDa subunit) (mRNA cap-binding protein) | EBI-921030 | 0.35 |
P84092 | AP-2 complex subunit mu (AP-2 mu chain) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Mu2-adaptin) (Plasma membrane adaptor AP-2 50 kDa protein) | EBI-921030 | 0.35 |
P20069 | Mitochondrial-processing peptidase subunit alpha (Alpha-MPP) (Inactive zinc metalloprotease alpha) (P-55) | EBI-921030 | 0.35 |
P19945 | 60S acidic ribosomal protein P0 (60S ribosomal protein L10E) | EBI-921030 | 0.35 |
P19804 | Nucleoside diphosphate kinase B (NDK B) (NDP kinase B) (EC 2.7.4.6) (Histidine protein kinase NDKB) (EC 2.7.13.3) (P18) | EBI-921030 | 0.35 |
P97536 | Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1) (TBP-interacting protein of 120 kDa A) (TBP-interacting protein 120A) (p120 CAND1) | EBI-921030 | 0.35 |
P42667 | Signal peptidase complex catalytic subunit SEC11A (EC 3.4.21.89) (Endopeptidase SP18) (Microsomal signal peptidase 18 kDa subunit) (SPase 18 kDa subunit) (SEC11 homolog A) (SEC11-like protein 1) (SPC18) | EBI-921030 | 0.35 |
P97519 | Hydroxymethylglutaryl-CoA lyase, mitochondrial (HL) (HMG-CoA lyase) (EC 4.1.3.4) (3-hydroxy-3-methylglutarate-CoA lyase) | EBI-921030 | 0.35 |
P83888 | Tubulin gamma-1 chain (Gamma-1-tubulin) (Gamma-tubulin complex component 1) (GCP-1) | EBI-921030 | 0.35 |
P83732 | 60S ribosomal protein L24 (L30) | EBI-921030 | 0.35 |
P81155 | Voltage-dependent anion-selective channel protein 2 (VDAC-2) (B36-VDAC) (Outer mitochondrial membrane protein porin 2) | EBI-921030 | 0.35 |
P80385 | 5'-AMP-activated protein kinase subunit gamma-1 (AMPK gamma1) (AMPK subunit gamma-1) (AMPKg) | EBI-921030 | 0.35 |
P70645 | Bleomycin hydrolase (BH) (BLM hydrolase) (BMH) (EC 3.4.22.40) | EBI-921030 | 0.35 |
Q5XIH7 | Prohibitin-2 (B-cell receptor-associated protein BAP37) (BAP-37) | EBI-921030 | 0.35 |
P70550 | Ras-related protein Rab-8B | EBI-921030 | 0.35 |
P70500 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase (EC 2.7.8.11) (Phosphatidylinositol synthase) (PI synthase) (PtdIns synthase) | EBI-921030 | 0.35 |
P70490 | Lactadherin (MFGM) (Milk fat globule-EGF factor 8) (MFG-E8) (O-acetyl GD3 ganglioside synthase) (AGS) (SED1) | EBI-921030 | 0.35 |
P62718 | 60S ribosomal protein L18a | EBI-921030 | 0.35 |
P62716 | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PP2A-beta) (EC 3.1.3.16) | EBI-921030 | 0.35 |
P62703 | 40S ribosomal protein S4, X isoform | EBI-921030 | 0.35 |
P62630 | Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor Tu) (EF-Tu) (Eukaryotic elongation factor 1 A-1) (eEF1A-1) | EBI-921030 | 0.35 |
P62628 | Dynein light chain roadblock-type 1 (Bithoraxoid-like protein) (BLP) (robl/LC7-like protein) (Dynein light chain 2A, cytoplasmic) (Dynein-associated protein Km23) | EBI-921030 | 0.35 |
P62425 | 60S ribosomal protein L7a | EBI-921030 | 0.35 |
P62332 | ADP-ribosylation factor 6 (EC 3.6.5.2) | EBI-921030 | 0.35 |
P62282 | 40S ribosomal protein S11 | EBI-921030 | 0.35 |
P62278 | 40S ribosomal protein S13 | EBI-921030 | 0.35 |
P62271 | 40S ribosomal protein S18 | EBI-921030 | 0.35 |
P62268 | 40S ribosomal protein S23 | EBI-921030 | 0.35 |
P62260 | 14-3-3 protein epsilon (14-3-3E) (Mitochondrial import stimulation factor L subunit) (MSF L) | EBI-921030 | 0.35 |
P62250 | 40S ribosomal protein S16 | EBI-921030 | 0.35 |
P62243 | 40S ribosomal protein S8 | EBI-921030 | 0.35 |
P62198 | 26S proteasome regulatory subunit 8 (26S proteasome AAA-ATPase subunit RPT6) (Proteasome 26S subunit ATPase 5) (Proteasome subunit p45) (Thyroid hormone receptor-interacting protein 1) (TRIP1) (p45/SUG) | EBI-921030 | 0.35 |
P62193 | 26S proteasome regulatory subunit 4 (P26s4) (26S proteasome AAA-ATPase subunit RPT2) (Proteasome 26S subunit ATPase 1) | EBI-921030 | 0.35 |
P62142 | Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PP-1B) (EC 3.1.3.16) (EC 3.1.3.53) | EBI-921030 | 0.35 |
P62138 | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16) | EBI-921030 | 0.35 |
P62083 | 40S ribosomal protein S7 (S8) | EBI-921030 | 0.35 |
P61983 | 14-3-3 protein gamma [Cleaved into: 14-3-3 protein gamma, N-terminally processed] | EBI-921030 | 0.35 |
P61980 | Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (dC stretch-binding protein) (CSBP) | EBI-921030 | 0.35 |
P61805 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (Oligosaccharyl transferase subunit DAD1) (Defender against cell death 1) (DAD-1) | EBI-921030 | 0.35 |
P61751 | ADP-ribosylation factor 4 | EBI-921030 | 0.35 |
P61621 | Protein transport protein Sec61 subunit alpha isoform 1 (Sec61 alpha-1) | EBI-921030 | 0.35 |
P61589 | Transforming protein RhoA (EC 3.6.5.2) | EBI-921030 | 0.35 |
O54980 | Synaptogyrin-2 (Cellugyrin) | EBI-921030 | 0.35 |
O54715 | V-type proton ATPase subunit S1 (V-ATPase subunit S1) (C7-1 protein) (V-ATPase Ac45 subunit) (V-ATPase S1 accessory protein) (Vacuolar proton pump subunit S1) | EBI-921030 | 0.35 |
O35854 | Branched-chain-amino-acid aminotransferase, mitochondrial (BCAT(m)) (EC 2.6.1.42) | EBI-921030 | 0.35 |
Q6IFV1 | Keratin, type I cytoskeletal 14 (Cytokeratin-14) (CK-14) (Keratin-14) (K14) (Type I keratin Ka14) | EBI-921030 | 0.35 |
O35796 | Complement component 1 Q subcomponent-binding protein, mitochondrial (GC1q-R protein) (Glycoprotein gC1qBP) (C1qBP) | EBI-921030 | 0.35 |
O35763 | Moesin (Membrane-organizing extension spike protein) | EBI-921030 | 0.35 |
O35511 | A regulatory subunit of protein phosphatase 2A | EBI-921030 | 0.35 |
O35509 | Ras-related protein Rab-11B (EC 3.6.5.2) | EBI-921030 | 0.35 |
Q5EGY4 | Synaptobrevin homolog YKT6 (EC 2.3.1.-) | EBI-921030 | 0.35 |
P16884 | Neurofilament heavy polypeptide (NF-H) (200 kDa neurofilament protein) (Neurofilament triplet H protein) | EBI-921030 | 0.35 |
O35264 | Platelet-activating factor acetylhydrolase IB subunit alpha2 (EC 3.1.1.47) (PAF acetylhydrolase 30 kDa subunit) (PAF-AH 30 kDa subunit) (PAF-AH subunit beta) (PAFAH subunit beta) (Platelet-activating factor acetylhydrolase alpha 2 subunit) (PAF-AH alpha 2) | EBI-921030 | 0.35 |
O35244 | Peroxiredoxin-6 (EC 1.11.1.27) (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (aiPLA2) (EC 3.1.1.4) (Antioxidant protein 2) (Glutathione-dependent peroxiredoxin) (Lysophosphatidylcholine acyltransferase 5) (LPC acyltransferase 5) (LPCAT-5) (Lyso-PC acyltransferase 5) (EC 2.3.1.23) (Non-selenium glutathione peroxidase) (NSGPx) (Thiol-specific antioxidant protein) | EBI-921030 | 0.35 |
O35142 | Coatomer subunit beta' (Beta'-coat protein) (Beta'-COP) (p102) | EBI-921030 | 0.35 |
O35094 | Mitochondrial import inner membrane translocase subunit TIM44 | EBI-921030 | 0.35 |
O08839 | Myc box-dependent-interacting protein 1 (Amphiphysin II) (Amphiphysin-like protein) (Bridging integrator 1) | EBI-921030 | 0.35 |
O08772 | Protein synthesis initiation factor 4AII | EBI-921030 | 0.35 |
O08651 | D-3-phosphoglycerate dehydrogenase (3-PGDH) (EC 1.1.1.95) | EBI-921030 | 0.35 |
O08618 | Phosphoribosyl pyrophosphate synthase-associated protein 2 (PRPP synthase-associated protein 2) (41 kDa phosphoribosypyrophosphate synthetase-associated protein) (PAP41) | EBI-921030 | 0.35 |
P19234 | NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial (EC 7.1.1.2) (NADH-ubiquinone oxidoreductase 24 kDa subunit) | EBI-921030 | 0.35 |
P06685 | Sodium/potassium-transporting ATPase subunit alpha-1 (Na(+)/K(+) ATPase alpha-1 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-1) | EBI-921030 | 0.35 |
P63039 | 60 kDa heat shock protein, mitochondrial (EC 5.6.1.7) (60 kDa chaperonin) (Chaperonin 60) (CPN60) (HSP-65) (Heat shock protein 60) (HSP-60) (Hsp60) (Mitochondrial matrix protein P1) | EBI-921030 | 0.35 |
P18484 | AP-2 complex subunit alpha-2 (100 kDa coated vesicle protein C) (Adaptor protein complex AP-2 subunit alpha-2) (Adaptor-related protein complex 2 subunit alpha-2) (Alpha-adaptin C) (Alpha2-adaptin) (Clathrin assembly protein complex 2 alpha-C large chain) (Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit) | EBI-921030 | 0.35 |
P18421 | Proteasome subunit beta type-1 (Macropain subunit C5) (Multicatalytic endopeptidase complex subunit C5) (Proteasome component C5) (Proteasome gamma chain) | EBI-921030 | 0.35 |
P18420 | Proteasome subunit alpha type-1 (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome component C2) (Proteasome nu chain) | EBI-921030 | 0.35 |
P18418 | Calreticulin (CALBP) (CRP55) (Calcium-binding protein 3) (CABP3) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) | EBI-921030 | 0.35 |
P18163 | Long-chain-fatty-acid--CoA ligase 1 (EC 6.2.1.3) (Arachidonate--CoA ligase) (EC 6.2.1.15) (Long-chain acyl-CoA synthetase 1) (LACS 1) (Long-chain-fatty-acid--CoA ligase, liver isozyme) (Phytanate--CoA ligase) (EC 6.2.1.24) | EBI-921030 | 0.35 |
P17764 | Acetyl-CoA acetyltransferase, mitochondrial (EC 2.3.1.9) (Acetoacetyl-CoA thiolase) | EBI-921030 | 0.35 |
P17220 | Proteasome subunit alpha type-2 (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) (Proteasome component C3) | EBI-921030 | 0.35 |
P17209 | Myosin light chain 4 (Myosin light chain 1, atrial isoform) | EBI-921030 | 0.35 |
P17164 | Tissue alpha-L-fucosidase (EC 3.2.1.51) (Alpha-L-fucosidase I) (Alpha-L-fucoside fucohydrolase 1) (Alpha-L-fucosidase 1) | EBI-921030 | 0.35 |
P17077 | 60S ribosomal protein L9 | EBI-921030 | 0.35 |
P17074 | 40S ribosomal protein S19 | EBI-921030 | 0.35 |
P61354 | 60S ribosomal protein L27 | EBI-921030 | 0.35 |
P62909 | 40S ribosomal protein S3 (EC 4.2.99.18) | EBI-921030 | 0.35 |
P17046 | Lysosome-associated membrane glycoprotein 2 (LAMP-2) (Lysosome-associated membrane protein 2) (CD107 antigen-like family member B) (LGP-110) (LGP-96) (Lysosomal membrane glycoprotein type B) (LGP-B) (CD antigen CD107b) | EBI-921030 | 0.35 |
P16975 | SPARC (Basement-membrane protein 40) (BM-40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine) | EBI-921030 | 0.35 |
P16638 | ATP-citrate synthase (EC 2.3.3.8) (ATP-citrate (pro-S-)-lyase) (Citrate cleavage enzyme) | EBI-921030 | 0.35 |
P62850 | 40S ribosomal protein S24 | EBI-921030 | 0.35 |
P16036 | Phosphate carrier protein, mitochondrial (Phosphate transport protein) (PTP) (Solute carrier family 25 member 3) | EBI-921030 | 0.35 |
P15999 | ATP synthase subunit alpha, mitochondrial (ATP synthase F1 subunit alpha) | EBI-921030 | 0.35 |
P15791 | Calcium/calmodulin-dependent protein kinase type II subunit delta (CaM kinase II subunit delta) (CaMK-II subunit delta) (EC 2.7.11.17) | EBI-921030 | 0.35 |
P15651 | Short-chain specific acyl-CoA dehydrogenase, mitochondrial (SCAD) (EC 1.3.8.1) (Butyryl-CoA dehydrogenase) | EBI-921030 | 0.35 |
P15178 | Aspartate--tRNA ligase, cytoplasmic (EC 6.1.1.12) (Aspartyl-tRNA synthetase) (AspRS) | EBI-921030 | 0.35 |
P14604 | Enoyl-CoA hydratase, mitochondrial (mECH) (mECH1) (EC 4.2.1.17) (EC 5.3.3.8) (Enoyl-CoA hydratase 1) (ECHS1) (Short-chain enoyl-CoA hydratase) (SCEH) | EBI-921030 | 0.35 |
P14562 | Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (120 kDa lysosomal membrane glycoprotein) (LGP-120) (CD107 antigen-like family member A) (CD antigen CD107a) | EBI-921030 | 0.35 |
P14408 | Fumarate hydratase, mitochondrial (Fumarase) (EC 4.2.1.2) | EBI-921030 | 0.35 |
P84100 | 60S ribosomal protein L19 | EBI-921030 | 0.35 |
P13803 | Electron transfer flavoprotein subunit alpha, mitochondrial (Alpha-ETF) | EBI-921030 | 0.35 |
P13596 | Neural cell adhesion molecule 1 (N-CAM-1) (NCAM-1) (CD antigen CD56) | EBI-921030 | 0.35 |
P13471 | 40S ribosomal protein S14 | EBI-921030 | 0.35 |
P13437 | 3-ketoacyl-CoA thiolase, mitochondrial (EC 2.3.1.16) (Acetyl-CoA acetyltransferase) (EC 2.3.1.9) (Acetyl-CoA acyltransferase) (Acyl-CoA hydrolase, mitochondrial) (EC 3.1.2.-, EC 3.1.2.1, EC 3.1.2.2) (Beta-ketothiolase) (Mitochondrial 3-oxoacyl-CoA thiolase) | EBI-921030 | 0.35 |
P13383 | Nucleolin (Protein C23) | EBI-921030 | 0.35 |
P13086 | Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial (EC 6.2.1.4) (EC 6.2.1.5) (Succinyl-CoA synthetase subunit alpha) (SCS-alpha) | EBI-921030 | 0.35 |
P62902 | 60S ribosomal protein L31 | EBI-921030 | 0.35 |
P12749 | 60S ribosomal protein L26 | EBI-921030 | 0.35 |
P12001 | 60S ribosomal protein L18 | EBI-921030 | 0.35 |
P11980 | Pyruvate kinase PKM (EC 2.7.1.40) (Pyruvate kinase muscle isozyme) (Threonine-protein kinase PKM2) (EC 2.7.11.1) (Tyrosine-protein kinase PKM2) (EC 2.7.10.2) | EBI-921030 | 0.35 |
P11960 | 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) (BCKDE1A) (BCKDH E1-alpha) | EBI-921030 | 0.35 |
P11884 | Aldehyde dehydrogenase, mitochondrial (EC 1.2.1.3) (ALDH class 2) (ALDH-E2) (ALDH1) | EBI-921030 | 0.35 |
P11883 | Aldehyde dehydrogenase, dimeric NADP-preferring (EC 1.2.1.5) (Aldehyde dehydrogenase family 3 member A1) (HTC-ALDH) (Tumor-associated aldehyde dehydrogenase) | EBI-921030 | 0.35 |
P11762 | Galectin-1 (Gal-1) (14 kDa lectin) (Beta-galactoside-binding lectin L-14-I) (Galaptin) (Lactose-binding lectin 1) (Lectin galactoside-binding soluble 1) (RL 14.5) (S-Lac lectin 1) | EBI-921030 | 0.35 |
P11730 | Calcium/calmodulin-dependent protein kinase type II subunit gamma (CaM kinase II subunit gamma) (CaMK-II subunit gamma) (EC 2.7.11.17) | EBI-921030 | 0.35 |
Q9QZK5 | Serine protease HTRA1 (EC 3.4.21.-) (High-temperature requirement A serine peptidase 1) (Serine protease 11) | EBI-921030 | 0.35 |
Q9QUR2 | Dynactin subunit 4 (Dynactin subunit p62) | EBI-921030 | 0.35 |
Q9JMJ4 | Pre-mRNA-processing factor 19 (EC 2.3.2.27) (Neuronal differentiation-related gene protein) (PRP19/PSO4 homolog) (RING-type E3 ubiquitin transferase PRP19) | EBI-921030 | 0.35 |
Q9JMB5 | Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Rpn13 homolog) | EBI-921030 | 0.35 |
Q9JLZ1 | Glutaredoxin-3 (PKC-interacting cousin of thioredoxin) (PICOT) (PKC-theta-interacting protein) (PKCq-interacting protein) (Thioredoxin-like protein 2) | EBI-921030 | 0.35 |
Q9JLH7 | CDK5 regulatory subunit-associated protein 3 (CDK5 activator-binding protein C53) | EBI-921030 | 0.35 |
Q9JLA3 | UDP-glucose:glycoprotein glucosyltransferase 1 (UGT1) (rUGT1) (EC 2.4.1.-) (UDP--Glc:glycoprotein glucosyltransferase) (UDP-glucose ceramide glucosyltransferase-like 1) | EBI-921030 | 0.35 |
Q9JK11 | Reticulon-4 (Foocen) (Glut4 vesicle 20 kDa protein) (Neurite outgrowth inhibitor) (Nogo protein) | EBI-921030 | 0.35 |
Q9JIJ7 | DEAD box protein 1 | EBI-921030 | 0.35 |
Q9JHY2 | Sideroflexin-3 | EBI-921030 | 0.35 |
Q9JHW5 | Vesicle-associated membrane protein 7 (VAMP-7) (Synaptobrevin-like protein 1) | EBI-921030 | 0.35 |
Q9JHW0 | Proteasome subunit beta type-7 (EC 3.4.25.1) (Macropain chain Z) (Multicatalytic endopeptidase complex chain Z) (Proteasome subunit Z) | EBI-921030 | 0.35 |
Q9JHU5 | Arfaptin-1 (ADP-ribosylation factor-interacting protein 1) | EBI-921030 | 0.35 |
Q9HB97 | Alpha-parvin (Actopaxin) | EBI-921030 | 0.35 |
Q9ES40 | PRA1 family protein 3 (ADP-ribosylation factor-like protein 6-interacting protein 5) (ARL-6-interacting protein 5) (Aip-5) (GTRAP3-18) (Glutamate transporter EAAC1-interacting protein) (Prenylated Rab acceptor protein 2) (Protein JWa) | EBI-921030 | 0.35 |
Q9ERR2 | COMM domain-containing protein 5 (Hypertension-related calcium-regulated gene protein) (HCaRG) | EBI-921030 | 0.35 |
Q9ERM8 | Secretory carrier-associated membrane protein (Secretory carrier membrane protein) | EBI-921030 | 0.35 |
Q9ERF9 | Actin-related protein 3 | EBI-921030 | 0.35 |
Q9ER30 | Kelch-like protein 41 (Kel-like protein 23) (Kelch repeat and BTB domain-containing protein 10) (Kelch-related protein 1) (Sarcosin) | EBI-921030 | 0.35 |
Q9EQX9 | Ubiquitin-conjugating enzyme E2 N (EC 2.3.2.23) (Bendless-like ubiquitin-conjugating enzyme) (E2 ubiquitin-conjugating enzyme N) (Ubiquitin carrier protein N) (Ubiquitin-protein ligase N) | EBI-921030 | 0.35 |
Q9EQV6 | Tripeptidyl-peptidase 1 (TPP-1) (EC 3.4.14.9) (Tripeptidyl aminopeptidase) (Tripeptidyl-peptidase I) (TPP-I) | EBI-921030 | 0.35 |
Q6P7S1 | Acid ceramidase (AC) (ACDase) (Acid CDase) (EC 3.5.1.23) (Acylsphingosine deacylase) (N-acylethanolamine hydrolase ASAH1) (EC 3.5.1.-) (N-acylsphingosine amidohydrolase) [Cleaved into: Acid ceramidase subunit alpha; Acid ceramidase subunit beta] | EBI-921030 | 0.35 |
Q9EPV3 | Endothelial monocyte-activating polypeptide II | EBI-921030 | 0.35 |
Q9EPJ3 | 28S ribosomal protein S26, mitochondrial (MRP-S26) (S26mt) (Protein 5'OT-EST) | EBI-921030 | 0.35 |
Q9EPH8 | Polyadenylate-binding protein 1 (PABP-1) (Poly(A)-binding protein 1) | EBI-921030 | 0.35 |
Q9EPC6 | Profilin-2 (Profilin II) | EBI-921030 | 0.35 |
Q9EPB1 | Dipeptidyl peptidase 2 (EC 3.4.14.2) (Dipeptidyl aminopeptidase II) (Dipeptidyl peptidase 7) (Dipeptidyl peptidase II) (DPP II) (Quiescent cell proline dipeptidase) | EBI-921030 | 0.35 |
Q99PW3 | Sialidase-1 (EC 3.2.1.18) (Lysosomal sialidase) (N-acetyl-alpha-neuraminidase 1) | EBI-921030 | 0.35 |
Q99PD4 | Actin-related protein 2/3 complex subunit 1A | EBI-921030 | 0.35 |
Q99NA6 | NAD+-specific isocitrate dehydrogenase b-subunit | EBI-921030 | 0.35 |
Q99NA5 | Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial (EC 1.1.1.41) (Isocitric dehydrogenase subunit alpha) (NAD(+)-specific ICDH subunit alpha) | EBI-921030 | 0.35 |
Q71TY3 | 40S ribosomal protein S27 | EBI-921030 | 0.35 |
Q71SY3 | Translin (Component 3 of promoter of RISC) | EBI-921030 | 0.35 |
Q71DI1 | Dermcidin | EBI-921030 | 0.35 |
Q5M9G3 | Caprin-1 (Cytoplasmic activation- and proliferation-associated protein 1) (GPI-anchored protein p137) (GPI-p137) (p137GPI) (RNA granule protein 105) | EBI-921030 | 0.35 |
Q6W3E9 | Prolyl 4-hydroxylase subunit alpha-3 (4-PH alpha-3) (EC 1.14.11.2) (Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-3) | EBI-921030 | 0.35 |
Q6TUG0 | DnaJ homolog subfamily B member 11 (ER-associated DNAJ) (ER-associated Hsp40 co-chaperone) (Endoplasmic reticulum DNA J domain-containing protein 3) (ER-resident protein ERdj3) (ERdj3) (ERj3p) (Liver regeneration-related protein LRRGT00084) | EBI-921030 | 0.35 |
Q6RUV5 | Ras-related C3 botulinum toxin substrate 1 (EC 3.6.5.2) (p21-Rac1) | EBI-921030 | 0.35 |
Q6RJR6 | Reticulon-3 | EBI-921030 | 0.35 |
Q2TA68 | Dynamin-like 120 kDa protein, mitochondrial (EC 3.6.5.5) (Optic atrophy protein 1 homolog) [Cleaved into: Dynamin-like 120 kDa protein, form S1] | EBI-921030 | 0.35 |
Q6QI88 | Transmembrane emp24 domain-containing protein 5 | EBI-921030 | 0.35 |
Q6QI86 | Immediate early response 3-interacting protein 1 | EBI-921030 | 0.35 |
Q6QI16 | RNA transcription, translation and transport factor protein | EBI-921030 | 0.35 |
Q6Q7Y5 | Guanine nucleotide-binding protein subunit alpha-13 (G alpha-13) (G-protein subunit alpha-13) | EBI-921030 | 0.35 |
Q6Q0N3 | 5'-nucleotidase domain-containing protein 2 (EC 3.1.3.-) | EBI-921030 | 0.35 |
Q6PEC5 | Sod_Cu domain-containing protein | EBI-921030 | 0.35 |
Q6PEC4 | S-phase kinase-associated protein 1 (Cyclin-A/CDK2-associated protein p19) (S-phase kinase-associated protein 1A) (p19A) (p19skp1) | EBI-921030 | 0.35 |
Q6PDV8 | 60S ribosomal protein L22 (RCG31311) (Ribosomal protein L22) (Ribosomal protein L22-like) | EBI-921030 | 0.35 |
Q6PDV7 | 60S ribosomal protein L10 (Ribosomal protein L10) | EBI-921030 | 0.35 |
Q6PDV1 | Lysozyme (EC 3.2.1.17) (1,4-beta-N-acetylmuramidase C) | EBI-921030 | 0.35 |
Q6PCU2 | V-type proton ATPase subunit E 1 (V-ATPase subunit E 1) (Vacuolar proton pump subunit E 1) | EBI-921030 | 0.35 |
Q6PCT9 | 26S proteasome non-ATPase regulatory subunit 6 | EBI-921030 | 0.35 |
Q68FQ0 | T-complex protein 1 subunit epsilon (TCP-1-epsilon) (CCT-epsilon) | EBI-921030 | 0.35 |
Q6P9V9 | Tubulin alpha-1B chain (EC 3.6.5.-) (Alpha-tubulin 2) (Tubulin alpha-2 chain) [Cleaved into: Detyrosinated tubulin alpha-1B chain] | EBI-921030 | 0.35 |
Q6P9U9 | Inosine-5'-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205) | EBI-921030 | 0.35 |
Q6P9U3 | COMM domain-containing protein 3 | EBI-921030 | 0.35 |
Q6P9U0 | Serine (Or cysteine) peptidase inhibitor, clade B, member 6a (Serine (Or cysteine) peptidase inhibitor, clade B, member 6a, isoform CRA_a) (Serpin family B member 6A) | EBI-921030 | 0.35 |
Q6P9T8 | Tubulin beta-4B chain (Tubulin beta-2C chain) | EBI-921030 | 0.35 |
Q6P7A9 | Lysosomal alpha-glucosidase (EC 3.2.1.20) (Acid maltase) | EBI-921030 | 0.35 |
Q6P799 | Serine--tRNA ligase, cytoplasmic (EC 6.1.1.11) (Seryl-tRNA synthetase) (SerRS) (Seryl-tRNA(Ser/Sec) synthetase) | EBI-921030 | 0.35 |
Q6P792 | Four and a half LIM domains 1 (Four and a half LIM domains 1, isoform CRA_b) | EBI-921030 | 0.35 |
Q6P791 | Ragulator complex protein LAMTOR1 (Late endosomal/lysosomal adaptor and MAPK and MTOR activator 1) (Lipid raft adaptor protein p18) | EBI-921030 | 0.35 |
Q6P777 | Multivesicular body subunit 12A (ESCRT-I complex subunit MVB12A) (Protein FAM125A) | EBI-921030 | 0.35 |
Q6P762 | Alpha-mannosidase (EC 3.2.1.-) | EBI-921030 | 0.35 |
Q6P6W6 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial | EBI-921030 | 0.35 |
Q6P6V8 | Myosin binding protein H | EBI-921030 | 0.35 |
Q9ES53 | Ubiquitin recognition factor in ER-associated degradation protein 1 (Ubiquitin fusion degradation protein 1 homolog) (UB fusion protein 1) | EBI-921030 | 0.35 |
Q9ER34 | Aconitate hydratase, mitochondrial (Aconitase) (EC 4.2.1.3) (Citrate hydro-lyase) | EBI-921030 | 0.35 |
Q6P6V0 | Glucose-6-phosphate isomerase (GPI) (EC 5.3.1.9) (Autocrine motility factor) (AMF) (Neuroleukin) (NLK) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) | EBI-921030 | 0.35 |
Q6P6R2 | Dihydrolipoyl dehydrogenase, mitochondrial (EC 1.8.1.4) (Dihydrolipoamide dehydrogenase) | EBI-921030 | 0.35 |
P68370 | Tubulin alpha-1A chain (EC 3.6.5.-) (Alpha-tubulin 1) (Tubulin alpha-1 chain) [Cleaved into: Detyrosinated tubulin alpha-1A chain] | EBI-921030 | 0.35 |
Q6P685 | Eukaryotic translation initiation factor 2 subunit beta (Eukaryotic translation initiation factor 2, subunit 2 (Beta)) (Eukaryotic translation initiation factor 2, subunit 2 (Beta), isoform CRA_a) | EBI-921030 | 0.35 |
Q6P503 | V-type proton ATPase subunit D (V-type proton ATPase subunit d) (Vacuolar proton pump subunit D) | EBI-921030 | 0.35 |
Q6P502 | T-complex protein 1 subunit gamma (TCP-1-gamma) (CCT-gamma) | EBI-921030 | 0.35 |
Q6P4Z9 | COP9 signalosome complex subunit 8 (SGN8) (Signalosome subunit 8) (COP9 homolog) (JAB1-containing signalosome subunit 8) | EBI-921030 | 0.35 |
Q6P2A5 | GTP:AMP phosphotransferase AK3, mitochondrial (EC 2.7.4.10) (Adenylate kinase 3) (AK 3) (Adenylate kinase 3 alpha-like 1) | EBI-921030 | 0.35 |
Q6P0K8 | Junction plakoglobin | EBI-921030 | 0.35 |
Q6NYB7 | Ras-related protein Rab-1A (EC 3.6.5.2) | EBI-921030 | 0.35 |
Q68FV6 | Glycosylated lysosomal membrane protein (Lysosomal protein NCU-G1) | EBI-921030 | 0.35 |
Q8R4A1 | ERO1-like protein alpha (ERO1-L) (ERO1-L-alpha) (EC 1.8.4.-) (Endoplasmic reticulum oxidoreductase alpha) (Endoplasmic reticulum oxidoreductin-1-like protein) (Global ischemia-induced protein 11) (Oxidoreductin-1-L-alpha) | EBI-921030 | 0.35 |
Q6AY48 | Poly(RC) binding protein 3 | EBI-921030 | 0.35 |
P56571 | ES1 protein homolog, mitochondrial | EBI-921030 | 0.35 |
Q5XIH3 | NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (EC 7.1.1.2) | EBI-921030 | 0.35 |
Q3MHT4 | Speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) (EC 2.7.7.19) (RNA-binding motif protein 21) (RNA-binding protein 21) (U6 snRNA-specific terminal uridylyltransferase 1) (U6-TUTase) (EC 2.7.7.52) | EBI-921030 | 0.35 |
Q9Z336 | Dynein light chain Tctex-type 1 (Activator of G-protein signaling 2) (AGS2) (T-complex testis-specific protein 1 homolog) | EBI-921030 | 0.35 |
Q9Z2X5 | Homer protein homolog 3 (Homer-3) (VASP/Ena-related gene up-regulated during seizure and LTP 3) (Vesl-3) | EBI-921030 | 0.35 |
Q9Z2Q1 | Protein transport protein Sec31A (SEC31-like protein 1) (SEC31-related protein A) (Vesicle-associated protein 1) | EBI-921030 | 0.35 |
Q9Z2L0 | Voltage-dependent anion-selective channel protein 1 (VDAC-1) (rVDAC1) (Outer mitochondrial membrane protein porin 1) | EBI-921030 | 0.35 |
Q6IRK9 | Carboxypeptidase Q (EC 3.4.17.-) (Hematopoietic lineage switch 2 related protein) (Hls2-rp) (Liver annexin-like protein 1) (LAL-1) (Plasma glutamate carboxypeptidase) | EBI-921030 | 0.35 |
Q9Z1X1 | Extended synaptotagmin-1 (E-Syt1) (Membrane-bound C2 domain-containing protein) (vp115) | EBI-921030 | 0.35 |
Q9Z1P2 | Alpha-actinin-1 (Alpha-actinin cytoskeletal isoform) (F-actin cross-linking protein) (Non-muscle alpha-actinin-1) | EBI-921030 | 0.35 |
Q9Z1E1 | Flotillin-1 (Reggie-2) (REG-2) | EBI-921030 | 0.35 |
Q9Z0V6 | Thioredoxin-dependent peroxide reductase, mitochondrial (EC 1.11.1.24) (PRx III) (Peroxiredoxin-3) (PRX-3) (Thioredoxin-dependent peroxiredoxin 3) | EBI-921030 | 0.35 |
Q9Z0V5 | Peroxiredoxin-4 (EC 1.11.1.24) (Antioxidant enzyme AOE372) (Peroxiredoxin IV) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Thioredoxin-dependent peroxiredoxin 4) | EBI-921030 | 0.35 |
Q9Z0U8 | Nucleic acid binding factor pRM10 | EBI-921030 | 0.35 |
Q9WVK7 | Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial (HCDH) (EC 1.1.1.35) (Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase) (Short-chain 3-hydroxyacyl-CoA dehydrogenase) | EBI-921030 | 0.35 |
Q9WVK3 | Peroxisomal trans-2-enoyl-CoA reductase (TERP) (EC 1.3.1.38) (PX-2,4-DCR1) (Peroxisomal 2,4-dienoyl-CoA reductase) (RLF98) | EBI-921030 | 0.35 |
Q9WVC0 | Septin-7 (CDC10 protein homolog) | EBI-921030 | 0.35 |
Q9WVB1 | Ras-related protein Rab-6A (Rab-6) | EBI-921030 | 0.35 |
Q2PQA9 | Kinesin-1 heavy chain (Conventional kinesin heavy chain) (Ubiquitous kinesin heavy chain) (UKHC) | EBI-921030 | 0.35 |
Q9WU82 | Catenin beta-1 (Beta-catenin) | EBI-921030 | 0.35 |
Q9WVR3 | Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 (EC 3.1.3.86) (Inositol polyphosphate phosphatase-like protein 1) (INPPL-1) (Protein 51C) (SH2 domain-containing inositol 5'-phosphatase 2) (SH2 domain-containing inositol phosphatase 2) (SHIP-2) | EBI-921030 | 0.35 |
Q9R1J8 | Prolyl 3-hydroxylase 1 (EC 1.14.11.7) (Leucine- and proline-enriched proteoglycan 1) (Leprecan-1) | EBI-921030 | 0.35 |
Q9R063 | Peroxiredoxin-5, mitochondrial (EC 1.11.1.24) (Antioxidant enzyme B166) (AOEB166) (PLP) (Peroxiredoxin V) (Prx-V) (Peroxisomal antioxidant enzyme) (Thioredoxin peroxidase PMP20) (Thioredoxin-dependent peroxiredoxin 5) | EBI-921030 | 0.35 |
Q9QZV8 | Type 2X myosin heavy chain | EBI-921030 | 0.35 |
Q9QZR6 | Septin-9 (Eighth septin) (Eseptin) (Septin-like protein) (SLP) | EBI-921030 | 0.35 |
Q99N27 | Sorting nexin-1 | EBI-921030 | 0.35 |
Q99J82 | Integrin-linked protein kinase (EC 2.7.11.1) (59 kDa serine/threonine-protein kinase) (Beta-integrin-linked kinase) (ILK-1) (ILK-2) (p59ILK) | EBI-921030 | 0.35 |
Q99068 | Alpha-2-macroglobulin receptor-associated protein (Alpha-2-MRAP) (Gp330-binding 45 kDa protein) (Low density lipoprotein receptor-related protein-associated protein 1) (RAP) | EBI-921030 | 0.35 |
Q924W3 | Integrin alpha 6 subchain | EBI-921030 | 0.35 |
Q924S5 | Lon protease homolog, mitochondrial (EC 3.4.21.53) (Lon protease-like protein) (LONP) (Mitochondrial ATP-dependent protease Lon) (Serine protease 15) | EBI-921030 | 0.35 |
Q924M6 | Apoptosis-inducing factor | EBI-921030 | 0.35 |
Q923V8 | Selenoprotein F (15 kDa selenoprotein) | EBI-921030 | 0.35 |
Q920L2 | Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (EC 1.3.5.1) (Flavoprotein subunit of complex II) (Fp) | EBI-921030 | 0.35 |
Q920J4 | Thioredoxin-like protein 1 (Thioredoxin-related protein) | EBI-921030 | 0.35 |
Q920A6 | Retinoid-inducible serine carboxypeptidase (EC 3.4.16.-) (Serine carboxypeptidase 1) | EBI-921030 | 0.35 |
Q91ZW6 | Trimethyllysine dioxygenase, mitochondrial (EC 1.14.11.8) (Epsilon-trimethyllysine 2-oxoglutarate dioxygenase) (TML hydroxylase) (TML-alpha-ketoglutarate dioxygenase) (TML dioxygenase) (TMLD) | EBI-921030 | 0.35 |
Q91Y81 | Septin-2 (Vascular endothelial cell specific protein 11) | EBI-921030 | 0.35 |
P82995 | Heat shock protein HSP 90-alpha (EC 3.6.4.10) (Heat shock 86 kDa) (HSP 86) (HSP86) | EBI-921030 | 0.35 |
Q91XL4 | G-protein beta-2 subunit | EBI-921030 | 0.35 |
Q8VHV7 | Heterogeneous nuclear ribonucleoprotein H (hnRNP H) (Ratsg1) [Cleaved into: Heterogeneous nuclear ribonucleoprotein H, N-terminally processed] | EBI-921030 | 0.35 |
Q8VHJ0 | AHNAK-related protein | EBI-921030 | 0.35 |
Q8VHI8 | Vesicle transport protein SEC20 | EBI-921030 | 0.35 |
Q8VHF5 | Citrate synthase, mitochondrial (EC 2.3.3.1) (Citrate (Si)-synthase) | EBI-921030 | 0.35 |
Q5XIP0 | DnaJ (Hsp40) homolog, subfamily B, member 4 (DnaJ (Hsp40) homolog, subfamily B, member 4, isoform CRA_a) (DnaJ heat shock protein family (Hsp40) member B4) | EBI-921030 | 0.35 |
Q5M7W1 | Thioredoxin-interacting protein (Vitamin D3 up-regulated protein 1) | EBI-921030 | 0.35 |
Q5XIT9 | Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial (MCCase subunit beta) (EC 6.4.1.4) (3-methylcrotonyl-CoA carboxylase 2) (3-methylcrotonyl-CoA carboxylase non-biotin-containing subunit) (3-methylcrotonyl-CoA:carbon dioxide ligase subunit beta) | EBI-921030 | 0.35 |
P56574 | Isocitrate dehydrogenase [NADP], mitochondrial (IDH) (EC 1.1.1.42) (ICD-M) (IDP) (NADP(+)-specific ICDH) (Oxalosuccinate decarboxylase) | EBI-921030 | 0.35 |
Q3T1L0 | Aldehyde dehydrogenase family 16 member A1 | EBI-921030 | 0.35 |
Q5FVH2 | 5'-3' exonuclease PLD3 (EC 3.1.16.1) (Choline phosphatase 3) (Phosphatidylcholine-hydrolyzing phospholipase D3) (Phospholipase D3) (PLD 3) | EBI-921030 | 0.35 |
Q4V8B7 | Inactive hydroxysteroid dehydrogenase-like protein 1 | EBI-921030 | 0.35 |
Q68FS9 | COMM domain containing 10, isoform CRA_a (COMM domain-containing 10) | EBI-921030 | 0.35 |
D3ZJR1 | Epidermal growth factor receptor pathway substrate 15-like 1 | EBI-921030 | 0.35 |
Q5EBA4 | Nipsnap1 protein | EBI-921030 | 0.35 |
Q68FW4 | Syntaxin-18 | EBI-921030 | 0.35 |
Q5XI73 | Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI alpha) | EBI-921030 | 0.35 |
Q6AY55 | Dephospho-CoA kinase domain-containing protein | EBI-921030 | 0.35 |
Q5U1Y1 | Ras-related protein Rab-34 | EBI-921030 | 0.35 |
Q3KR97 | Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 (BAI1-associated protein 2-like protein 1) | EBI-921030 | 0.35 |
Q4V8B5 | Coiled-coil domain-containing protein 116 | EBI-921030 | 0.35 |
Q66H98 | Caveolae-associated protein 2 (Cavin-2) (Phosphatidylserine-binding protein) (Serum deprivation-response protein) | EBI-921030 | 0.35 |
Q5BJX1 | 39S ribosomal protein L41, mitochondrial (L41mt) (MRP-L41) | EBI-921030 | 0.35 |
Q5FVH0 | Complement C1q tumor necrosis factor-related protein 5 | EBI-921030 | 0.35 |
Q8R491 | EH domain-containing protein 3 | EBI-921030 | 0.35 |
Q3KR80 | Arylsulfatase A | EBI-921030 | 0.35 |
Q32KK2 | Arylsulfatase A (EC 3.1.6.8) (Arylsulfatase A, isoform CRA_a) | EBI-921030 | 0.35 |
Q66H12 | Alpha-N-acetylgalactosaminidase (EC 3.2.1.49) (Alpha-galactosidase B) | EBI-921030 | 0.35 |
P11598 | Protein disulfide-isomerase A3 (EC 5.3.4.1) (58 kDa glucose-regulated protein) (58 kDa microsomal protein) (p58) (Disulfide isomerase ER-60) (Endoplasmic reticulum resident protein 57) (ER protein 57) (ERp57) (Endoplasmic reticulum resident protein 60) (ER protein 60) (ERp60) (HIP-70) (Q-2) | EBI-921030 | 0.35 |
P61212 | ADP-ribosylation factor-like protein 1 | EBI-921030 | 0.35 |
P61107 | Ras-related protein Rab-14 | EBI-921030 | 0.35 |
P61023 | Calcineurin B homologous protein 1 (Calcineurin B-like protein) (Calcium-binding protein CHP) (Calcium-binding protein p22) (EF-hand calcium-binding domain-containing protein p22) | EBI-921030 | 0.35 |
P60901 | Proteasome subunit alpha type-6 (Macropain iota chain) (Multicatalytic endopeptidase complex iota chain) (Proteasome iota chain) | EBI-921030 | 0.35 |
P60892 | Ribose-phosphate pyrophosphokinase 1 (EC 2.7.6.1) (Phosphoribosyl pyrophosphate synthase I) (PRS-I) | EBI-921030 | 0.35 |
P60711 | Actin, cytoplasmic 1 (EC 3.6.4.-) (Beta-actin) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed] | EBI-921030 | 0.35 |
P58405 | Striatin-3 (Cell cycle autoantigen SG2NA) (S/G2 antigen) | EBI-921030 | 0.35 |
P55161 | Nck-associated protein 1 (NAP 1) (Membrane-associated protein HEM-2) (p125Nap1) | EBI-921030 | 0.35 |
P54921 | Alpha-soluble NSF attachment protein (SNAP-alpha) (N-ethylmaleimide-sensitive factor attachment protein alpha) | EBI-921030 | 0.35 |
P54311 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 (Transducin beta chain 1) | EBI-921030 | 0.35 |
P54001 | Prolyl 4-hydroxylase subunit alpha-1 (4-PH alpha-1) (EC 1.14.11.2) (Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-1) | EBI-921030 | 0.35 |
P62907 | 60S ribosomal protein L10a | EBI-921030 | 0.35 |
P52944 | PDZ and LIM domain protein 1 (C-terminal LIM domain protein 1) (Elfin) (LIM domain protein CLP-36) | EBI-921030 | 0.35 |
P52555 | Endoplasmic reticulum resident protein 29 (ERp29) (Endoplasmic reticulum resident protein 31) (ERp31) | EBI-921030 | 0.35 |
P51868 | Calsequestrin-2 (Calsequestrin, cardiac muscle isoform) | EBI-921030 | 0.35 |
P51583 | Bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS) [Includes: Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) (AIR carboxylase) (AIRC); Phosphoribosylaminoimidazole succinocarboxamide synthetase (EC 6.3.2.6) (SAICAR synthetase)] | EBI-921030 | 0.35 |
P50878 | 60S ribosomal protein L4 (60S ribosomal protein L1) | EBI-921030 | 0.35 |
P62815 | V-type proton ATPase subunit B, brain isoform (V-ATPase subunit B 2) (Endomembrane proton pump 58 kDa subunit) (Vacuolar proton pump subunit B 2) | EBI-921030 | 0.35 |
P50503 | Hsc70-interacting protein (Hip) (Protein FAM10A1) (Protein ST13 homolog) | EBI-921030 | 0.35 |
P50430 | Arylsulfatase B (ASB) (EC 3.1.6.12) (N-acetylgalactosamine-4-sulfatase) (G4S) | EBI-921030 | 0.35 |
P50408 | V-type proton ATPase subunit F (V-ATPase subunit F) (V-ATPase 14 kDa subunit) (Vacuolar proton pump subunit F) | EBI-921030 | 0.35 |
P50137 | Transketolase (TK) (EC 2.2.1.1) | EBI-921030 | 0.35 |
P49432 | Pyruvate dehydrogenase E1 component subunit beta, mitochondrial (PDHE1-B) (EC 1.2.4.1) | EBI-921030 | 0.35 |
P49242 | 40S ribosomal protein S3a (V-fos transformation effector protein) [Cleaved into: 40S ribosomal protein S3b] | EBI-921030 | 0.35 |
P49134 | Integrin beta-1 (Beta oligodendroglia) (Beta OL) (Fibronectin receptor subunit beta) (VLA-4 subunit beta) (CD antigen CD29) | EBI-921030 | 0.35 |
P48721 | Stress-70 protein, mitochondrial (75 kDa glucose-regulated protein) (GRP-75) (Heat shock 70 kDa protein 9) (Mortalin) (Peptide-binding protein 74) (PBP74) (mtHSP70) | EBI-921030 | 0.35 |
P48675 | Desmin | EBI-921030 | 0.35 |
P48500 | Triosephosphate isomerase (TIM) (EC 5.3.1.1) (Methylglyoxal synthase) (EC 4.2.3.3) (Triose-phosphate isomerase) | EBI-921030 | 0.35 |
P48037 | Annexin A6 (Annexin VI) (Annexin-6) (Calcium-binding protein 65/67) (CBP 65/67) | EBI-921030 | 0.35 |
P48004 | Proteasome subunit alpha type-7 (Proteasome subunit RC6-1) | EBI-921030 | 0.35 |
P47942 | Dihydropyrimidinase-related protein 2 (DRP-2) (Collapsin response mediator protein 2) (CRMP-2) (Turned on after division 64 kDa protein) (TOAD-64) | EBI-921030 | 0.35 |
P47853 | Biglycan (Bone/cartilage proteoglycan I) (PG-S1) | EBI-921030 | 0.35 |
P46462 | Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) | EBI-921030 | 0.35 |
P45592 | Cofilin-1 (Cofilin, non-muscle isoform) | EBI-921030 | 0.35 |
P45479 | Palmitoyl-protein thioesterase 1 (PPT-1) (EC 3.1.2.22) (Palmitoyl-protein hydrolase 1) | EBI-921030 | 0.35 |
P42930 | Heat shock protein beta-1 (HspB1) (Heat shock 27 kDa protein) (HSP 27) | EBI-921030 | 0.35 |
Q6MGB8 | RT1 class I, A2 (RT1 class Ia, A2n) (RT1 class Ia, locus A2) | EBI-921030 | 0.35 |
P97629 | Leucyl-cystinyl aminopeptidase (Cystinyl aminopeptidase) (EC 3.4.11.3) (GP160) (Insulin-regulated membrane aminopeptidase) (Insulin-responsive aminopeptidase) (IRAP) (Oxytocinase) (OTase) (Placental leucine aminopeptidase) (P-LAP) (Vesicle protein of 165 kDa) (Vp165) | EBI-921030 | 0.35 |
Q6MGB5 | (3R)-3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.n12) (17-beta-hydroxysteroid dehydrogenase 8) (17-beta-HSD 8) (3-ketoacyl-[acyl-carrier-protein] reductase alpha subunit) (KAR alpha subunit) (3-oxoacyl-[acyl-carrier-protein] reductase) (Estradiol 17-beta-dehydrogenase 8) (EC 1.1.1.62) (Testosterone 17-beta-dehydrogenase 8) (EC 1.1.1.239) | EBI-921030 | 0.35 |
Q6MG76 | Superkiller viralicidic activity 2-like (S. cerevisiae) | EBI-921030 | 0.35 |
P55063 | Heat shock 70 kDa protein 1-like (Heat shock 70 kDa protein 1L) (Heat shock 70 kDa protein 3) (HSP70.3) | EBI-921030 | 0.35 |
Q6MG60 | N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 (DDAH-2) (Dimethylarginine dimethylaminohydrolase 2) (EC 3.5.3.18) (DDAHII) (Dimethylargininase-2) | EBI-921030 | 0.35 |
Q6MG30 | RT1 class I, CE14 | EBI-921030 | 0.35 |
Q6LED0 | Histone H3.1 | EBI-921030 | 0.35 |
Q6J4T4 | Epithelial protein lost in neoplasm isoform beta | EBI-921030 | 0.35 |
Q62636 | Ras-related protein Rap-1b (EC 3.6.5.2) (GTP-binding protein smg p21B) | EBI-921030 | 0.35 |
Q6IRE4 | Tumor susceptibility gene 101 protein (ESCRT-I complex subunit TSG101) | EBI-921030 | 0.35 |
Q66X93 | Staphylococcal nuclease domain-containing protein 1 (EC 3.1.31.1) (100 kDa coactivator) (SND p102) (p100 co-activator) (p105 coactivator) | EBI-921030 | 0.35 |
Q6IN22 | Cathepsin B (EC 3.4.22.1) | EBI-921030 | 0.35 |
Q6IMX8 | Acyl-CoA thioesterase 2 (Acyl-coenzyme A thioesterase 2, mitochondrial) (RCG20653) | EBI-921030 | 0.35 |
P28073 | Proteasome subunit beta type-6 (EC 3.4.25.1) (Macropain delta chain) (Multicatalytic endopeptidase complex delta chain) (Proteasome chain 5) (Proteasome delta chain) (Proteasome subunit Y) | EBI-921030 | 0.35 |
Q6IE67 | Proteasome subunit alpha type | EBI-921030 | 0.35 |
Q6GQP4 | Ras-related protein Rab-31 (GTP-binding protein Rab0) | EBI-921030 | 0.35 |
Q9JLJ3 | 4-trimethylaminobutyraldehyde dehydrogenase (TMABA-DH) (TMABADH) (EC 1.2.1.47) (Aldehyde dehydrogenase family 9 member A1) (EC 1.2.1.3) (Gamma-aminobutyraldehyde dehydrogenase) (EC 1.2.1.19) | EBI-921030 | 0.35 |
Q64591 | 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial (EC 1.3.1.124) (2,4-dienoyl-CoA reductase [NADPH]) (4-enoyl-CoA reductase [NADPH]) | EBI-921030 | 0.35 |
Q64560 | Tripeptidyl-peptidase 2 (TPP-2) (EC 3.4.14.10) (Tripeptidyl aminopeptidase) (Tripeptidyl-peptidase II) (TPP-II) | EBI-921030 | 0.35 |
Q64537 | Calpain small subunit 1 (CSS1) (Calcium-activated neutral proteinase small subunit) (CANP small subunit) (Calcium-dependent protease small subunit) (CDPS) (Calcium-dependent protease small subunit 1) (Calpain regulatory subunit) | EBI-921030 | 0.35 |
Q64536 | [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial (EC 2.7.11.2) (PDK P45) (Pyruvate dehydrogenase kinase isoform 2) (PDH kinase 2) | EBI-921030 | 0.35 |
Q64375 | Endoplasmic reticulum protein SC65 (Leprecan-like protein 4) (Prolyl 3-hydroxylase family member 4) (Synaptonemal complex protein SC65) | EBI-921030 | 0.35 |
Q64232 | Very-long-chain enoyl-CoA reductase (EC 1.3.1.93) (Synaptic glycoprotein SC2) (Trans-2,3-enoyl-CoA reductase) (TER) | EBI-921030 | 0.35 |
Q63965 | Sideroflexin-1 (Tricarboxylate carrier protein) (TCC) | EBI-921030 | 0.35 |
Q63750 | 39S ribosomal protein L23, mitochondrial (L23mt) (MRP-L23) (L23 mitochondrial-related protein) | EBI-921030 | 0.35 |
Q63716 | Peroxiredoxin-1 (EC 1.11.1.24) (HBP23) (Heme-binding 23 kDa protein) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Thioredoxin-dependent peroxiredoxin 1) | EBI-921030 | 0.35 |
Q63699 | Cyclin-dependent kinase 2 (EC 2.7.11.22) (Cell division protein kinase 2) | EBI-921030 | 0.35 |
Q63635 | Syntaxin-6 | EBI-921030 | 0.35 |
Q63615 | Vacuolar protein sorting-associated protein 33A (r-vps33a) | EBI-921030 | 0.35 |
Q63598 | Plastin-3 (T-plastin) | EBI-921030 | 0.35 |
Q63584 | Transmembrane emp24 domain-containing protein 10 (Protein Tmed10) (21 kDa transmembrane-trafficking protein) (Transmembrane protein Tmp21) (p24 family protein delta-1) (p24delta1) | EBI-921030 | 0.35 |
Q63570 | 26S proteasome regulatory subunit 6B (26S proteasome AAA-ATPase subunit RPT3) (Proteasome 26S subunit ATPase 4) (S6 ATPase) (Tat-binding protein 7) (TBP-7) | EBI-921030 | 0.35 |
Q63569 | 26S proteasome regulatory subunit 6A (26S proteasome AAA-ATPase subunit RPT5) (Proteasome 26S subunit ATPase 3) (Spermatogenic cell/sperm-associated Tat-binding protein homolog SATA) (Tat-binding protein 1) (TBP-1) | EBI-921030 | 0.35 |
P62870 | Elongin-B (EloB) (Elongin 18 kDa subunit) (RNA polymerase II transcription factor SIII subunit B) (SIII p18) (Transcription elongation factor B polypeptide 2) | EBI-921030 | 0.35 |
Q9QZM5 | Abl interactor 1 (Abelson interactor 1) (Abi-1) (Eps8 SH3 domain-binding protein) (Eps8-binding protein) (e3B1) | EBI-921030 | 0.35 |
G3V6H1 | Galactocerebrosidase (EC 3.2.1.46) (Galactosylceramidase) | EBI-921030 | 0.35 |
Q5FWT1 | Protein FAM98A | EBI-921030 | 0.35 |
Q5XI43 | Matrix remodeling-associated protein 8 (Limitrin) | EBI-921030 | 0.35 |
Q5U2V8 | ER membrane protein complex subunit 3 (Transmembrane protein 111) | EBI-921030 | 0.35 |
Q4KM74 | Vesicle-trafficking protein SEC22b (ER-Golgi SNARE of 24 kDa) (ERS-24) (ERS24) (SEC22 vesicle-trafficking protein homolog B) (SEC22 vesicle-trafficking protein-like 1) | EBI-921030 | 0.35 |
Q5BJK8 | Golgi integral membrane protein 4 (Golgi integral membrane protein, cis) (GIMPc) (Golgi phosphoprotein 4) | EBI-921030 | 0.35 |
Q5U302 | Catenin (Cadherin associated protein), alpha 1 (Catenin (Cadherin-associated protein), alpha 1, isoform CRA_b) (Catenin alpha 1) | EBI-921030 | 0.35 |
Q4QQV0 | Tubulin beta chain | EBI-921030 | 0.35 |
Q5EB77 | Ras-related protein Rab-18 | EBI-921030 | 0.35 |
Q5XII0 | Mammalian ependymin-related protein 1 (MERP-1) | EBI-921030 | 0.35 |
Q5XID6 | Gamma-sarcoglycan | EBI-921030 | 0.35 |
Q3B7V5 | RAB2B, member RAS oncogene family (RCG61209, isoform CRA_a) | EBI-921030 | 0.35 |
Q5BJT7 | Coiled-coil domain-containing protein 93 | EBI-921030 | 0.35 |
Q5FVQ4 | Malectin | EBI-921030 | 0.35 |
Q4G061 | Eukaryotic translation initiation factor 3 subunit B (eIF3b) (Eukaryotic translation initiation factor 3 subunit 9) (eIF-3-eta) | EBI-921030 | 0.35 |
Q5M843 | 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 3 (EC 1.14.11.-) | EBI-921030 | 0.35 |
Q5XIQ4 | E3 ubiquitin-protein ligase MGRN1 (EC 2.3.2.27) (Mahogunin RING finger protein 1) (RING-type E3 ubiquitin transferase MGRN1) | EBI-921030 | 0.35 |
D4A414 | COX15 homolog, cytochrome c oxidase assembly protein (Yeast), isoform CRA_a (Cytochrome c oxidase assembly homolog COX15) | EBI-921030 | 0.35 |
Q5PQM3 | Ehbp1l1 protein (RCG47454, isoform CRA_d) | EBI-921030 | 0.35 |
Q32PX6 | Ras homolog family member G (Ras homolog gene family, member G) (Ras homolog gene family, member G (Rho G)) | EBI-921030 | 0.35 |
Q5U2X8 | Acyl-CoA thioesterase 9 (Similar to acyl-CoA thioesterase, isoform CRA_b) | EBI-921030 | 0.35 |
Q68FT7 | Phenylalanine--tRNA ligase beta subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase beta subunit) | EBI-921030 | 0.35 |
Q4G067 | Mitochondrial ribosomal protein L44 | EBI-921030 | 0.35 |
Q4V8H5 | Aspartyl aminopeptidase (EC 3.4.11.21) | EBI-921030 | 0.35 |
Q5XIM0 | Mitochondrial chaperone BCS1 (BCS1-like protein) | EBI-921030 | 0.35 |
Q5PQL2 | CCR4-NOT transcription complex subunit 9 (Cell differentiation protein RQCD1 homolog) (Rcd-1) | EBI-921030 | 0.35 |
Q7TP47 | Heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) (Liver regeneration-related protein LRRG077) (Synaptotagmin-binding, cytoplasmic RNA-interacting protein) | EBI-921030 | 0.35 |
Q68FY0 | Cytochrome b-c1 complex subunit 1, mitochondrial (Complex III subunit 1) (Core protein I) (Ubiquinol-cytochrome-c reductase complex core protein 1) | EBI-921030 | 0.35 |
Q7TP24 | Signal recognition particle receptor subunit beta | EBI-921030 | 0.35 |
Q7TMC7 | Signal recognition particle receptor subunit beta | EBI-921030 | 0.35 |
P05426 | 60S ribosomal protein L7 | EBI-921030 | 0.35 |
Q641X3 | Beta-hexosaminidase subunit alpha (EC 3.2.1.52) (Beta-N-acetylhexosaminidase subunit alpha) (Hexosaminidase subunit A) (N-acetyl-beta-glucosaminidase subunit alpha) | EBI-921030 | 0.35 |
Q68FR9 | Elongation factor 1-delta (EF-1-delta) | EBI-921030 | 0.35 |
Q5U3Z7 | Serine hydroxymethyltransferase (EC 2.1.2.1) | EBI-921030 | 0.35 |
Q32KJ5 | N-acetylglucosamine-6-sulfatase (EC 3.1.6.14) (Glucosamine-6-sulfatase) | EBI-921030 | 0.35 |
Q6AYH5 | Dynactin subunit 2 | EBI-921030 | 0.35 |
Q5M918 | N-acetylglucosamine-6-sulfatase (EC 3.1.6.14) (Glucosamine-6-sulfatase) | EBI-921030 | 0.35 |
Q5XIM9 | T-complex protein 1 subunit beta (TCP-1-beta) (CCT-beta) | EBI-921030 | 0.35 |
Q5XIU4 | B-cell receptor-associated protein (BCR-associated protein) | EBI-921030 | 0.35 |
Q3KRE0 | ATPase family AAA domain-containing protein 3 | EBI-921030 | 0.35 |
Q498E0 | Thioredoxin domain-containing protein 12 (EC 1.8.4.2) | EBI-921030 | 0.35 |
Q4FZT0 | Stomatin-like protein 2, mitochondrial (SLP-2) | EBI-921030 | 0.35 |
Q5XIG8 | Serine-threonine kinase receptor-associated protein (UNR-interacting protein) | EBI-921030 | 0.35 |
Q4AEF8 | Coatomer subunit gamma-1 (Gamma-1-coat protein) (Gamma-1-COP) | EBI-921030 | 0.35 |
P81799 | N-acetyl-D-glucosamine kinase (N-acetylglucosamine kinase) (EC 2.7.1.59) (GlcNAc kinase) | EBI-921030 | 0.35 |
Q66H94 | Peptidyl-prolyl cis-trans isomerase FKBP9 (PPIase FKBP9) (EC 5.2.1.8) (FK506-binding protein 9) (FKBP-9) (Rotamase) | EBI-921030 | 0.35 |
Q5XI04 | RCG45489, isoform CRA_a (Stomatin) | EBI-921030 | 0.35 |
Q6AYS3 | Carboxypeptidase (EC 3.4.16.-) | EBI-921030 | 0.35 |
Q3MIE7 | COMM domain containing 9, isoform CRA_a (COMM domain containing 9, isoform CRA_b) (COMM domain-containing 9) | EBI-921030 | 0.35 |
Q68FT4 | Succinate-CoA ligase subunit beta (EC 6.2.1.-) | EBI-921030 | 0.35 |
P68511 | 14-3-3 protein eta | EBI-921030 | 0.35 |
P11507 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) (SR Ca(2+)-ATPase 2) (EC 7.2.2.10) (Calcium pump 2) (Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase) | EBI-921030 | 0.35 |
P11442 | Clathrin heavy chain 1 | EBI-921030 | 0.35 |
P11240 | Cytochrome c oxidase subunit 5A, mitochondrial (Cytochrome c oxidase polypeptide Va) | EBI-921030 | 0.35 |
P11232 | Thioredoxin (Trx) | EBI-921030 | 0.35 |
P62845 | 40S ribosomal protein S15 (RIG protein) | EBI-921030 | 0.35 |
P62963 | Profilin-1 (Profilin I) | EBI-921030 | 0.35 |
P10888 | Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (Cytochrome c oxidase polypeptide IV) (Cytochrome c oxidase subunit IV isoform 1) (COX IV-1) | EBI-921030 | 0.35 |
P10860 | Glutamate dehydrogenase 1, mitochondrial (GDH 1) (EC 1.4.1.3) (Memory-related gene 2 protein) (MRG-2) | EBI-921030 | 0.35 |
P10760 | Adenosylhomocysteinase (AdoHcyase) (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase) | EBI-921030 | 0.35 |
P10719 | ATP synthase subunit beta, mitochondrial (EC 7.1.2.2) (ATP synthase F1 subunit beta) | EBI-921030 | 0.35 |
P62755 | 40S ribosomal protein S6 | EBI-921030 | 0.35 |
P63326 | 40S ribosomal protein S10 | EBI-921030 | 0.35 |
P09895 | 60S ribosomal protein L5 | EBI-921030 | 0.35 |
P09527 | Ras-related protein Rab-7a (EC 3.6.5.2) (Ras-related protein BRL-RAS) (Ras-related protein p23) | EBI-921030 | 0.35 |
P09456 | cAMP-dependent protein kinase type I-alpha regulatory subunit [Cleaved into: cAMP-dependent protein kinase type I-alpha regulatory subunit, N-terminally processed] | EBI-921030 | 0.35 |
P63324 | 40S ribosomal protein S12 | EBI-921030 | 0.35 |
P09330 | Ribose-phosphate pyrophosphokinase 2 (EC 2.7.6.1) (Phosphoribosyl pyrophosphate synthase II) (PRS-II) | EBI-921030 | 0.35 |
P08503 | Medium-chain specific acyl-CoA dehydrogenase, mitochondrial (MCAD) (EC 1.3.8.7) | EBI-921030 | 0.35 |
P08461 | Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (EC 2.3.1.12) (70 kDa mitochondrial autoantigen of primary biliary cirrhosis) (PBC) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex) (Pyruvate dehydrogenase complex component E2) (PDC-E2) (PDCE2) | EBI-921030 | 0.35 |
P08413 | Calcium/calmodulin-dependent protein kinase type II subunit beta (CaM kinase II subunit beta) (CaMK-II subunit beta) (EC 2.7.11.17) | EBI-921030 | 0.35 |
P63018 | Heat shock cognate 71 kDa protein (EC 3.6.4.10) (Heat shock 70 kDa protein 8) | EBI-921030 | 0.35 |
P08081 | Clathrin light chain A (Lca) | EBI-921030 | 0.35 |
P08010 | Glutathione S-transferase Mu 2 (EC 2.5.1.18) (GST 4-4) (GSTM2-2) (Glutathione S-transferase Yb-2) (GST Yb2) | EBI-921030 | 0.35 |
P07895 | Superoxide dismutase [Mn], mitochondrial (EC 1.15.1.1) | EBI-921030 | 0.35 |
P07872 | Peroxisomal acyl-coenzyme A oxidase 1 (ACO) (AOX) (EC 1.3.3.6) (Palmitoyl-CoA oxidase) (Peroxisomal fatty acyl-CoA oxidase) (Straight-chain acyl-CoA oxidase) [Cleaved into: Peroxisomal acyl-CoA oxidase 1, A chain; Peroxisomal acyl-CoA oxidase 1, B chain; Peroxisomal acyl-CoA oxidase 1, C chain] | EBI-921030 | 0.35 |
P07871 | 3-ketoacyl-CoA thiolase B, peroxisomal (EC 2.3.1.155) (EC 2.3.1.16) (EC 2.3.1.9) (Acetyl-CoA acyltransferase B) (Beta-ketothiolase B) (Peroxisomal 3-oxoacyl-CoA thiolase B) | EBI-921030 | 0.35 |
P07824 | Arginase-1 (EC 3.5.3.1) (Liver-type arginase) (Type I arginase) | EBI-921030 | 0.35 |
P07633 | Propionyl-CoA carboxylase beta chain, mitochondrial (PCCase subunit beta) (EC 6.4.1.3) (Propanoyl-CoA:carbon dioxide ligase subunit beta) | EBI-921030 | 0.35 |
P07154 | Procathepsin L (EC 3.4.22.15) (Cathepsin L1) (Cyclic protein 2) (CP-2) (Major excreted protein) (MEP) [Cleaved into: Cathepsin L; Cathepsin L heavy chain; Cathepsin L light chain] | EBI-921030 | 0.35 |
P07153 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit) (Ribophorin I) (RPN-I) (Ribophorin-1) | EBI-921030 | 0.35 |
P07150 | Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35) [Cleaved into: Annexin Ac2-26] | EBI-921030 | 0.35 |
P06761 | Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein) (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein) (Steroidogenesis-activator polypeptide) | EBI-921030 | 0.35 |
P06760 | Beta-glucuronidase (EC 3.2.1.31) | EBI-921030 | 0.35 |
P63100 | Calcineurin subunit B type 1 (Protein phosphatase 2B regulatory subunit 1) (Protein phosphatase 3 regulatory subunit B alpha isoform 1) | EBI-921030 | 0.35 |
P41123 | 60S ribosomal protein L13 | EBI-921030 | 0.35 |
P40307 | Proteasome subunit beta type-2 (Macropain subunit C7-I) (Multicatalytic endopeptidase complex subunit C7-I) (Proteasome component C7-I) | EBI-921030 | 0.35 |
P40112 | Proteasome subunit beta type-3 (Proteasome chain 13) (Proteasome component C10-II) (Proteasome theta chain) | EBI-921030 | 0.35 |
P39052 | Dynamin-2 (EC 3.6.5.5) | EBI-921030 | 0.35 |
P62914 | 60S ribosomal protein L11 | EBI-921030 | 0.35 |
P38983 | 40S ribosomal protein SA (37 kDa laminin receptor precursor) (37LRP) (37/67 kDa laminin receptor) (LRP/LR) (67 kDa laminin receptor) (67LR) (Laminin receptor 1) (LamR) (Laminin-binding protein precursor p40) (LBP/p40) | EBI-921030 | 0.35 |
P38659 | Protein disulfide-isomerase A4 (EC 5.3.4.1) (Calcium-binding protein 2) (CaBP2) (Endoplasmic reticulum resident protein 70) (ER protein 70) (ERp70) (Endoplasmic reticulum resident protein 72) (ER protein 72) (ERp-72) (ERp72) | EBI-921030 | 0.35 |
P38650 | Cytoplasmic dynein 1 heavy chain 1 (Cytoplasmic dynein heavy chain 1) (Dynein heavy chain, cytosolic) (MAP 1C) | EBI-921030 | 0.35 |
P37397 | Calponin-3 (Calponin, acidic isoform) (Calponin, non-muscle isoform) | EBI-921030 | 0.35 |
P37285 | Kinesin light chain 1 (KLC 1) | EBI-921030 | 0.35 |
P63088 | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit) | EBI-921030 | 0.35 |
P36972 | Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) | EBI-921030 | 0.35 |
P35704 | Peroxiredoxin-2 (EC 1.11.1.24) (Thiol-specific antioxidant protein) (TSA) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thioredoxin-dependent peroxiredoxin 2) | EBI-921030 | 0.35 |
P35565 | Calnexin | EBI-921030 | 0.35 |
P35435 | ATP synthase subunit gamma, mitochondrial (ATP synthase F1 subunit gamma) (F-ATPase gamma subunit) | EBI-921030 | 0.35 |
P35434 | ATP synthase subunit delta, mitochondrial (ATP synthase F1 subunit delta) (F-ATPase delta subunit) | EBI-921030 | 0.35 |
P35427 | 60S ribosomal protein L13a | EBI-921030 | 0.35 |
P35286 | Ras-related protein Rab-13 | EBI-921030 | 0.35 |
P35284 | Ras-related protein Rab-12 | EBI-921030 | 0.35 |
P68255 | 14-3-3 protein theta (14-3-3 protein tau) | EBI-921030 | 0.35 |
P63102 | 14-3-3 protein zeta/delta (Mitochondrial import stimulation factor S1 subunit) (Protein kinase C inhibitor protein 1) (KCIP-1) | EBI-921030 | 0.35 |
P35213 | 14-3-3 protein beta/alpha (Prepronerve growth factor RNH-1) (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein beta/alpha, N-terminally processed] | EBI-921030 | 0.35 |
P35053 | Glypican-1 (HSPG M12) [Cleaved into: Secreted glypican-1] | EBI-921030 | 0.35 |
P34926 | Microtubule-associated protein 1A (MAP-1A) [Cleaved into: MAP1A heavy chain; MAP1 light chain LC2] | EBI-921030 | 0.35 |
P34064 | Proteasome subunit alpha type-5 (Macropain zeta chain) (Multicatalytic endopeptidase complex zeta chain) (Proteasome zeta chain) | EBI-921030 | 0.35 |
P34058 | Heat shock protein HSP 90-beta (Heat shock 84 kDa) (HSP 84) (HSP84) | EBI-921030 | 0.35 |
P32551 | Cytochrome b-c1 complex subunit 2, mitochondrial (Complex III subunit 2) (Core protein II) (Ubiquinol-cytochrome-c reductase complex core protein 2) | EBI-921030 | 0.35 |
P32089 | Tricarboxylate transport protein, mitochondrial (Citrate carrier) (CIC) (Citrate transport protein) (CTP) (Solute carrier family 25 member 1) (Tricarboxylate carrier protein) | EBI-921030 | 0.35 |
P31977 | Ezrin (Cytovillin) (Villin-2) (p81) | EBI-921030 | 0.35 |
P31399 | ATP synthase subunit d, mitochondrial (ATPase subunit d) (ATP synthase peripheral stalk subunit d) | EBI-921030 | 0.35 |
P31232 | Transgelin (Smooth muscle protein 22-alpha) (SM22-alpha) | EBI-921030 | 0.35 |
P31000 | Vimentin | EBI-921030 | 0.35 |
P30904 | Macrophage migration inhibitory factor (MIF) (EC 5.3.2.1) (Glutathione-binding 13 kDa protein) (L-dopachrome isomerase) (L-dopachrome tautomerase) (EC 5.3.3.12) (Phenylpyruvate tautomerase) | EBI-921030 | 0.35 |
P30839 | Aldehyde dehydrogenase family 3 member A2 (EC 1.2.1.3) (EC 1.2.1.94) (Aldehyde dehydrogenase 4) (Fatty aldehyde dehydrogenase) (Microsomal aldehyde dehydrogenase) (msALDH) | EBI-921030 | 0.35 |
P30427 | Plectin (PCN) (PLTN) (Plectin-1) | EBI-921030 | 0.35 |
P29457 | Serpin H1 (47 kDa heat shock protein) (Collagen-binding protein) (Colligin) (GP46) | EBI-921030 | 0.35 |
P29419 | ATP synthase subunit e, mitochondrial (ATPase subunit e) (ATP synthase membrane subunit e) | EBI-921030 | 0.35 |
P29315 | Ribonuclease inhibitor (Ribonuclease/angiogenin inhibitor 1) | EBI-921030 | 0.35 |
P29314 | 40S ribosomal protein S9 | EBI-921030 | 0.35 |
Q63507 | 60S ribosomal protein L14 | EBI-921030 | 0.35 |
Q63448 | Peroxisomal acyl-coenzyme A oxidase 3 (EC 1.3.3.6) (Branched-chain acyl-CoA oxidase) (BRCACox) (Pristanoyl-CoA oxidase) | EBI-921030 | 0.35 |
P62982 | Ubiquitin-40S ribosomal protein S27a (Ubiquitin carboxyl extension protein 80) [Cleaved into: Ubiquitin; 40S ribosomal protein S27a] | EBI-921030 | 0.35 |
Q63377 | Sodium/potassium-transporting ATPase subunit beta-3 (Sodium/potassium-dependent ATPase subunit beta-3) (ATPB-3) (CD antigen CD298) | EBI-921030 | 0.35 |
Q63347 | 26S proteasome regulatory subunit 7 (26S proteasome AAA-ATPase subunit RPT1) (Proteasome 26S subunit ATPase 2) | EBI-921030 | 0.35 |
Q63321 | Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 (EC 1.14.11.4) (Lysyl hydroxylase 1) (LH1) | EBI-921030 | 0.35 |
Q63312 | Pleckstrin homology-like domain family B member 1 (Protein LL5-alpha) | EBI-921030 | 0.35 |
Q63258 | Integrin alpha-7 (H36-alpha7) [Cleaved into: Integrin alpha-7 heavy chain; Integrin alpha-7 light chain; Integrin alpha-7 70 kDa form] | EBI-921030 | 0.35 |
Q63151 | Fatty acid CoA ligase Acsl3 (Arachidonate--CoA ligase Acsl3) (EC 6.2.1.15) (Brain acyl-CoA synthetase II) (Long-chain acyl-CoA synthetase 3) (LACS 3) (Long-chain-fatty-acid--CoA ligase 3) (EC 6.2.1.3) (Medium-chain acyl-CoA ligase Acsl3) (EC 6.2.1.2) | EBI-921030 | 0.35 |
Q63083 | Nucleobindin-1 (Bone 63 kDa calcium-binding protein) (CALNUC) | EBI-921030 | 0.35 |
Q63081 | Protein disulfide-isomerase A6 (EC 5.3.4.1) (Calcium-binding protein 1) (CaBP1) (Protein disulfide isomerase P5) (Thioredoxin domain-containing protein 7) | EBI-921030 | 0.35 |
P02454 | Collagen alpha-1(I) chain (Alpha-1 type I collagen) | EBI-921030 | 0.35 |
Q63016 | Large neutral amino acids transporter small subunit 1 (4F2 light chain) (4F2 LC) (4F2LC) (Integral membrane protein E16) (Protein TA1) (L-type amino acid transporter 1) (LAT-1) (Solute carrier family 7 member 5) | EBI-921030 | 0.35 |
Q63002 | Mannose 6-phosphate/insulin-like growth factor II receptor | EBI-921030 | 0.35 |
Q62952 | Dihydropyrimidinase-related protein 3 (DRP-3) (Collapsin response mediator protein 4) (CRMP-4) (TOAD-64/Ulip/CRMP) (TUC-4b) | EBI-921030 | 0.35 |
Q62920 | PDZ and LIM domain protein 5 (Enigma homolog) (Enigma-like PDZ and LIM domains protein) | EBI-921030 | 0.35 |
Q62908 | Cysteine and glycine-rich protein 2 (Cysteine-rich protein 2) (CRP2) (Smooth muscle cell LIM protein) (SmLIM) | EBI-921030 | 0.35 |
Q62902 | Protein ERGIC-53 (ER-Golgi intermediate compartment 53 kDa protein) (Lectin mannose-binding 1) (p58) | EBI-921030 | 0.35 |
Q62871 | Cytoplasmic dynein 1 intermediate chain 2 (Cytoplasmic dynein intermediate chain 2) (Dynein intermediate chain 2, cytosolic) (DH IC-2) | EBI-921030 | 0.35 |
Q62991 | Sec1 family domain-containing protein 1 (SLY1 homolog) (Sly1p) (Syntaxin-binding protein 1-like 2) (Vesicle transport-related protein Ra410) | EBI-921030 | 0.35 |
Q62786 | Prostaglandin F2 receptor negative regulator (CD9 partner 1) (CD9P-1) (Glu-Trp-Ile EWI motif-containing protein F) (EWI-F) (Prostaglandin F2-alpha receptor regulatory protein) (Prostaglandin F2-alpha receptor-associated protein) (CD antigen CD315) | EBI-921030 | 0.35 |
Q62764 | Y-box-binding protein 3 (Cold shock domain-containing protein A) (DNA-binding protein A) (Muscle Y-box protein YB2) (RYB-A) (Y-box-binding protein A) | EBI-921030 | 0.35 |
Q62698 | Cytoplasmic dynein 1 light intermediate chain 2 (Dynein light intermediate chain 2, cytosolic) (LIC-2) (LIC53/55) | EBI-921030 | 0.35 |
Q62667 | Major vault protein (MVP) | EBI-921030 | 0.35 |
Q62638 | Golgi apparatus protein 1 (E-selectin ligand 1) (ESL-1) (Golgi sialoglycoprotein MG-160) | EBI-921030 | 0.35 |
Q60587 | Trifunctional enzyme subunit beta, mitochondrial (TP-beta) [Includes: 3-ketoacyl-CoA thiolase (EC 2.3.1.155) (EC 2.3.1.16) (Acetyl-CoA acyltransferase) (Beta-ketothiolase)] | EBI-921030 | 0.35 |
P62997 | Transformer-2 protein homolog beta (TRA-2 beta) (TRA2-beta) (RA301) (Splicing factor, arginine/serine-rich 10) (Transformer-2 protein homolog B) | EBI-921030 | 0.35 |
P63170 | Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) | EBI-921030 | 0.35 |
Q10758 | Keratin, type II cytoskeletal 8 (Cytokeratin endo A) (Cytokeratin-8) (CK-8) (Keratin-8) (K8) (Type-II keratin Kb8) | EBI-921030 | 0.35 |
Q10728 | Protein phosphatase 1 regulatory subunit 12A (MBSP) (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (Protein phosphatase myosin-binding subunit) (Protein phosphatase subunit 1M) (PP-1M) (Serine/threonine protein phosphatase PP1 smooth muscle regulatory subunit M110) | EBI-921030 | 0.35 |
Q09073 | ADP/ATP translocase 2 (ADP,ATP carrier protein 2) (Adenine nucleotide translocator 2) (ANT 2) (Solute carrier family 25 member 5) [Cleaved into: ADP/ATP translocase 2, N-terminally processed] | EBI-921030 | 0.35 |
Q08850 | Syntaxin-4 | EBI-921030 | 0.35 |
Q08163 | Adenylyl cyclase-associated protein 1 (CAP 1) | EBI-921030 | 0.35 |
Q07984 | Translocon-associated protein subunit delta (TRAP-delta) (Signal sequence receptor subunit delta) (SSR-delta) | EBI-921030 | 0.35 |
Q07936 | Annexin A2 (Annexin II) (Annexin-2) (Calpactin I heavy chain) (Calpactin-1 heavy chain) (Chromobindin-8) (Lipocortin II) (Placental anticoagulant protein IV) (PAP-IV) (Protein I) (p36) | EBI-921030 | 0.35 |
Q07266 | Drebrin (Developmentally-regulated brain protein) | EBI-921030 | 0.35 |
Q06647 | ATP synthase subunit O, mitochondrial (ATP synthase peripheral stalk subunit OSCP) (Oligomycin sensitivity conferral protein) (OSCP) (Sperm flagella protein 4) | EBI-921030 | 0.35 |
Q05962 | ADP/ATP translocase 1 (ADP,ATP carrier protein 1) (Adenine nucleotide translocator 1) (ANT 1) (Solute carrier family 25 member 4) | EBI-921030 | 0.35 |
Q04462 | Valine--tRNA ligase (EC 6.1.1.9) (Valyl-tRNA synthetase) (ValRS) | EBI-921030 | 0.35 |
Q02253 | Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial (MMSDH) (Malonate-semialdehyde dehydrogenase [acylating]) (EC 1.2.1.18) (EC 1.2.1.27) (Aldehyde dehydrogenase family 6 member A1) | EBI-921030 | 0.35 |
Q01205 | Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (OGDC-E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) (E2K) | EBI-921030 | 0.35 |
Q00972 | [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial (EC 2.7.11.4) (Branched-chain alpha-ketoacid dehydrogenase kinase) (BCKD-kinase) (BCKDHKIN) | EBI-921030 | 0.35 |
P97852 | Peroxisomal multifunctional enzyme type 2 (MFE-2) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-bifunctional protein) (DBP) (Multifunctional protein 2) (MFP-2) [Cleaved into: (3R)-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.n12); Enoyl-CoA hydratase 2 (EC 4.2.1.107) (EC 4.2.1.119) (3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase)] | EBI-921030 | 0.35 |