Protein Information |
|
|---|---|
| Protein Name | Importin subunit beta-4 |
| Accession Code | P40069 |
| Gene | KAP123 |
| Organism | Saccharomyces cerevisiae S288C (Taxonomy: 559292) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 1113) | |
|
MDQQFLSQLEQTLHAITSGVGLKEATKTLQTQFYTQPTTLPALIHILQNGSDDSLKQLAGVEARKLVSKHWNAIDESTRASIKTSLLQTAFSEPKENVRHSNARVIASIGTEELDGNKWPDLVPNLIQTA SGEDVQTRQTAIFILFSLLEDFTSSLSGHIDDFLALFSQTINDPSSLEIRSLSAQALNHVSALIEEQETINPVQAQKFAASIPSVVNVLDAVIKADDTMNAKLIFNCLNDFLLLDSQLTGNFIVDLIKLS LQIAVNSEIDEDVRVFALQFIISSLSYRKSKVSQSKLGPEITVAALKVACEEIDVDDELNNEDETGENEENTPSSSAIRLLAFASSELPPSQVASVIVEHIPAMLQSANVFERRAILLAISVAVTGSPDY ILSQFDKIIPATINGLKDTEPIVKLAALKCIHQLTTDLQDEVAKFHEEYLPLIIDIIDSAKNIVIYNYATVALDGLLEFIAYDAIAKYLDPLMNKLFYMLESNESSKLRCAVVSAIGSAAFAAGSAFIPY FKTSVHYLEKFIQNCSQIEGMSEDDIELRANTFENISTMARAVRSDAFAEFAEPLVNSAYEAIKTDSARLRESGYAFIANLAKVYGENFAPFLKTILPEIFKTLELDEYQFNFDGDAEDLAAFADSANEE ELQNKFTVNTGISYEKEVASAALSELALGTKEHFLPYVEQSLKVLNEQVDESYGLRETALNTIWNVVKSVLLASKVEPESYPKGIPASSYVNADVLAVIQAARETSMGNLSDEFETSMVITVMEDFANMI KQFGAIIIMDNGDSSMLEALCMQVLSVLKGTHTCQTIDIEEDVPRDEELDASETEATLQDVALEVLVSLSQALAGDFAKVFDNFRPVVFGLFQSKSKNKRSSAVGAASELALGMKEQNPFVHEMLEALVI RLTSDKSLEVRGNAAYGVGLLCEYASMDISAVYEPVLKALYELLSAADQKALAAEDDEATREIIDRAYANASGCVARMALKNSALVPLEQTVPALLAHLPLNTGFEEYNPIFELIMKLYQENSPVITNET PRIIEIFSAVFTKENDRIKLEKESTLGREENMERLKQFQTEEMKHKVIELLKYLNTTYNGIVAQNPVLAAVIA |
|
Description |
||
|---|---|---|
| Cytoplasm {Experimental EvidencePubMed:9238021, Experimental EvidencePubMed:9321403}. Nucleus {Experimental EvidencePubMed:9238021, Experimental EvidencePubMed:9321403}. Nucleus, nuclear pore complex {Experimental EvidencePubMed:9321403}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Nuclear Envelope | SL-0178 | The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space. |
| Nuclear Pore Complex | SL-0185 | The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs). | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Cytoplasm (GO:0005737) Cytoplasmic Stress Granule (GO:0010494) Nuclear Pore (GO:0005643) Nucleus (GO:0005634) |
|
Description |
|
|---|---|
| Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Its predominant cargo substrate seems to be ribosomal proteins (PubMed:9321403). Required for import of the ribosomal assembly factor NMD3 (PubMed:12612077). May be involved in nuclear transport of YAP1 (PubMed:11274141). Mediates the nuclear import of histones H3 and H4 (PubMed:11694505). Mediates docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to repeat-containing nucleoporins. The complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism (PubMed:11423015). At the nucleoplasmic side of the NPC, GTP- Ran binding leads to release of the cargo (PubMed:9321403). The importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (PubMed:11423015). {Experimental EvidencePubMed:11274141, Experimental EvidencePubMed:12612077, Experimental EvidencePubMed:9321403, Curator InferencePubMed:11423015}. | Assigned Ontology terms |
| Biological Process | MRNA Transport (GO:0051028) NLS-Bearing Protein Import Into Nucleus (GO:0006607) Protein Import Into Nucleus (GO:0006606) Regulation Of Pseudohyphal Growth (GO:2000220) |
| Molecular Function | Nuclear Import Signal Receptor Activity (GO:0061608) Nuclear Localization Sequence Binding (GO:0008139) Small GTPase Binding (GO:0031267) |
Interactions with Nuclear Envelope proteins (14 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| P32499 | Nucleoporin NUP2 | EBI-801825 | 0.35 |
| P34077 | Nucleoporin NIC96 | EBI-789044 | 0.35 |
| P39705 | Nucleoporin NUP60 | EBI-810484 | 0.67 |
| Q06616 | Nuclear envelope protein YPR174C | EBI-794693 | 0.53 |
| P47054 | Nucleoporin NUP192 | EBI-809765 | 0.35 |
| P52593 | Nucleoporin NUP188 | EBI-809801 | 0.35 |
| P40075 | Vesicle-associated membrane protein-associated protein SCS2 | EBI-7043141 | 0.35 |
| Q12063 | Dehydrodolichyl diphosphate synthase complex subunit NUS1 | EBI-16287555 | 0.35 |
| P38242 | UDP-N-acetylglucosamine transferase subunit ALG14 | EBI-804270 | 0.35 |
| P12683 | 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 | EBI-786893 | 0.35 |
| P12684 | 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 | EBI-787291 | 0.35 |
| Q02821 | Importin subunit alpha | EBI-804491 | 0.53 |
| Q06142 | Importin subunit beta-1 | EBI-784458 | 0.35 |
| P38217 | Importin subunit beta-2 | EBI-810745 | 0.35 | Interactions with other proteins (199 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| P39935 | Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (Translation initiation factor 4(4)-F(6) subunit gamma(3) protein 1) (eIF4G1) (mRNA cap-binding protein complex subunit p150) | EBI-7102517 | 0.40 |
| P38720 | 6-phosphogluconate dehydrogenase, decarboxylating 1 (EC 1.1.1.44) | EBI-738927 | 0.35 |
| P33892 | eIF-2-alpha kinase activator GCN1 (General control non-derepressible protein 1) (Translational activator GCN1) | EBI-784561 | 0.35 |
| P40499 | Protein ICE2 (Inheritance of cortical ER protein 2) | EBI-784605 | 0.35 |
| P16522 | Anaphase-promoting complex subunit CDC23 (Cell division control protein 23) | EBI-784904 | 0.35 |
| P53012 | Acyl-coenzyme A diphosphatase SCS3 (EC 3.6.1.-) (FIT family protein SCS3) | EBI-784913 | 0.35 |
| Q02785 | ATP-dependent permease PDR12 | EBI-785248 | 0.35 |
| P38310 | Iron transporter FTH1 | EBI-785385 | 0.35 |
| P36013 | NAD-dependent malic enzyme, mitochondrial (NAD-ME) (EC 1.1.1.38) | EBI-785404 | 0.35 |
| P38085 | Valine/tyrosine/tryptophan amino-acid permease 1 (Tyrosine and tryptophan amino acid transporter 1) | EBI-785720 | 0.35 |
| P20107 | Zinc/cadmium resistance protein | EBI-786095 | 0.35 |
| P53742 | Nucleolar GTP-binding protein 2 | EBI-786111 | 0.35 |
| P07262 | NADP-specific glutamate dehydrogenase 1 (NADP-GDH 1) (EC 1.4.1.4) (NADP-dependent glutamate dehydrogenase 1) | EBI-786325 | 0.35 |
| P32454 | Aminopeptidase 2, mitochondrial (AP-II) (Aminopeptidase II) (EC 3.4.11.-) (YscII) | EBI-786482 | 0.35 |
| P35723 | Endoplasmic reticulum transmembrane protein 1 | EBI-786542 | 0.35 |
| P32905 | 40S ribosomal protein S0-A (Nucleic acid-binding protein NAB1A) (Small ribosomal subunit protein uS2-A) | EBI-786584 | 0.53 |
| P33441 | THO complex subunit MFT1 (Mitochondrial fusion target protein 1) | EBI-786653 | 0.35 |
| P21147 | Acyl-CoA desaturase 1 (EC 1.14.19.1) (Delta 9 fatty acid desaturase) (Fatty acid desaturase 1) (Stearoyl-CoA desaturase 1) | EBI-786767 | 0.35 |
| P52910 | Acetyl-coenzyme A synthetase 2 (EC 6.2.1.1) (Acetate--CoA ligase 2) (Acyl-activating enzyme 2) | EBI-787020 | 0.35 |
| P42842 | Essential for maintenance of the cell wall protein 1 | EBI-787059 | 0.53 |
| P11075 | Protein transport protein SEC7 | EBI-787105 | 0.35 |
| P38152 | Tricarboxylate transport protein (Citrate transport protein) (CTP) | EBI-787191 | 0.35 |
| Q99190 | Very-long-chain enoyl-CoA reductase (EC 1.3.1.93) (Enoyl reductase TSC13) (Temperature-sensitive CSG2 suppressor protein 13) (Trans-2-enoyl-CoA reductase) | EBI-787497 | 0.35 |
| P32798 | Cobalt uptake protein COT1 | EBI-787527 | 0.35 |
| P18414 | ER lumen protein-retaining receptor (Endoplasmic reticulum retention defective protein 2) (HDEL receptor) | EBI-787591 | 0.35 |
| P40060 | Ino eighty subunit 5 | EBI-787692 | 0.35 |
| Q12029 | Sideroflexin FSF1 (Fungal sideroflexin-1) | EBI-787943 | 0.35 |
| Q04013 | Citrate/oxoglutarate carrier protein (Coc1p) (Mitochondrial DNA replication protein YHM2) | EBI-787999 | 0.53 |
| Q12345 | Ino eighty subunit 3 | EBI-788466 | 0.35 |
| P04840 | Mitochondrial outer membrane protein porin 1 (Voltage-dependent anion-selective channel protein 1) (VDAC-1) | EBI-789381 | 0.53 |
| P22211 | Nitrogen permease reactivator protein (EC 2.7.11.1) (Serine/threonine-protein kinase NPR1) | EBI-789829 | 0.35 |
| P00546 | Cyclin-dependent kinase 1 (CDK1) (EC 2.7.11.22) (Cell division control protein 28) (Cell division protein kinase 1) | EBI-790005 | 0.35 |
| P53045 | C-4 methylsterol oxidase ERG25 (EC 1.14.18.-) (Ergosterol biosynthetic protein 25) (Sterol-C4-methyl oxidase ERG25) (SMO) | EBI-790631 | 0.35 |
| P38719 | ATP-dependent RNA helicase DBP8 (EC 3.6.4.13) (DEAD box protein 8) | EBI-791466 | 0.53 |
| P35191 | DnaJ homolog 1, mitochondrial | EBI-791750 | 0.35 |
| P39743 | Reduced viability upon starvation protein 167 | EBI-791998 | 0.53 |
| P40541 | Cohesin subunit SCC3 (Irregular cell behavior protein 1) | EBI-792117 | 0.35 |
| P33333 | 1-acyl-sn-glycerol-3-phosphate acyltransferase (1-AGP acyltransferase) (1-AGPAT) (EC 2.3.1.23) (EC 2.3.1.51) (EC 2.3.1.n7) (Lysophosphatidic acid acyltransferase) (LPAAT) (Sphingolipid compensation protein 1) | EBI-792539 | 0.35 |
| P32476 | Squalene epoxidase ERG1 (SE) (EC 1.14.14.17) (Ergosterol biosynthetic protein 1) (Squalene monooxygenase ERG1) | EBI-792746 | 0.35 |
| P32467 | Low-affinity glucose transporter HXT4 (Low-affinity glucose transporter LGT1) | EBI-792844 | 0.35 |
| P32803 | Endosomal protein P24B (24 kDa endomembrane protein) (Basic 24 kDa late endocytic intermediate component) | EBI-792992 | 0.35 |
| P38853 | Kelch repeat-containing protein 1 | EBI-793202 | 0.35 |
| P28496 | Ceramide synthase LAC1 (Very-long-chain ceramide synthase LAC1) (EC 2.3.1.297) | EBI-793629 | 0.35 |
| P07279 | 60S ribosomal protein L18-A (Large ribosomal subunit protein eL18-A) (RP28) | EBI-793825 | 0.35 |
| P53965 | Inositol phosphatase SIW14 (EC 3.6.1.52) (5-PP-InsP phosphatase) (Inositol pyrophosphate phosphatase SIW14) (Oxidant-induced cell-cycle arrest protein 3) (Synthetic interaction with WHI2 protein 14) | EBI-794192 | 0.35 |
| P36008 | Elongation factor 1-gamma 2 (EF-1-gamma 2) (Eukaryotic elongation factor 1Bgamma 2) (eEF1Bgamma 2) (Translation elongation factor 1B gamma 2) | EBI-794719 | 0.35 |
| P53217 | Uncharacterized membrane protein YGR026W | EBI-795519 | 0.35 |
| P39522 | Dihydroxy-acid dehydratase, mitochondrial (DAD) (EC 4.2.1.9) | EBI-796511 | 0.35 |
| P48563 | Protein MON2 | EBI-796544 | 0.35 |
| P40416 | Iron-sulfur clusters transporter ATM1, mitochondrial (EC 7.-.-.-) | EBI-796874 | 0.35 |
| P41940 | Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1-phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP-hexose pyrophosphorylase) | EBI-797068 | 0.35 |
| P32629 | Mannan polymerase II complex ANP1 subunit (M-Pol II subunit ANP1) (Aminonitrophenyl propanediol resistance protein) | EBI-797496 | 0.35 |
| P28003 | SWIRM domain-containing protein FUN19 | EBI-797693 | 0.63 |
| Q07084 | Osmolarity two-component system protein SSK1 | EBI-797765 | 0.35 |
| Q07804 | Sterol esterase 1 (EC 3.1.1.13) (Steryl ester hydrolase 1) | EBI-797939 | 0.35 |
| P38707 | Asparagine--tRNA ligase, cytoplasmic (EC 6.1.1.22) (Asparaginyl-tRNA synthetase) (AsnRS) | EBI-798527 | 0.35 |
| P36148 | Glycerol-3-phosphate O-acyltransferase 2 (G-3-P acyltransferase 2) (GPAT 2) (EC 2.3.1.15) (Dihydroxyacetone phosphate acyltransferase 2) (DHAP-AT 2) (EC 2.3.1.42) (Glycerol-3-phosphate / dihydroxyacetone phosphate acyltransferase 2) | EBI-798681 | 0.35 |
| P12385 | Eukaryotic peptide chain release factor subunit 1 (Eukaryotic release factor 1) (eRF1) (Omnipotent suppressor protein 1) | EBI-798708 | 0.35 |
| P54837 | Endoplasmic reticulum vesicle protein 25 | EBI-798956 | 0.35 |
| P38703 | Ceramide synthase LAG1 (Longevity assurance factor 1) (Longevity assurance gene 1 protein) (Longevity assurance protein 1) (Very-long-chain ceramide synthase LAG1) (EC 2.3.1.297) | EBI-799064 | 0.35 |
| P29496 | Minichromosome maintenance protein 5 (EC 3.6.4.12) (Cell division control protein 46) | EBI-799159 | 0.35 |
| Q07560 | Cardiolipin synthase (CMP-forming) (CLS) (EC 2.7.8.41) | EBI-799843 | 0.35 |
| P16550 | Protein APA1 [Includes: Diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase 1 (Ap4A phosphorylase 1) (EC 2.7.7.53) (ADP-sulfurylase) (EC 2.7.7.5) (ATP adenylyltransferase) (Diadenosine tetraphosphate alpha,beta-phosphorylase (ADP-forming))] | EBI-799867 | 0.35 |
| P38687 | Signal recognition particle subunit SRP68 (Signal recognition particle 68 kDa protein homolog) | EBI-800067 | 0.35 |
| P23500 | Mitochondrial RNA-splicing protein MRS4 | EBI-800292 | 0.35 |
| P05626 | ATP synthase subunit 4, mitochondrial | EBI-800337 | 0.40 |
| P53881 | 54S ribosomal protein L22, mitochondrial (Mitochondrial large ribosomal subunit protein uL22m) | EBI-800899 | 0.35 |
| P02309 | Histone H4 | EBI-801642 | 0.53 |
| Q04182 | ATP-dependent permease PDR15 | EBI-802063 | 0.35 |
| Q02336 | Transcriptional adapter 2 | EBI-802105 | 0.35 |
| P40495 | Homoisocitrate dehydrogenase, mitochondrial (HIcDH) (EC 1.1.1.87) | EBI-802128 | 0.35 |
| P50108 | Probable alpha-1,6-mannosyltransferase MNN10 (EC 2.4.1.-) (Bud emergence delay protein 1) (Mannan polymerase II complex MNN10 subunit) (M-Pol II subunit MNN10) | EBI-802587 | 0.53 |
| P33748 | Zinc finger protein MSN2 (Multicopy suppressor of SNF1 protein 2) | EBI-802616 | 0.35 |
| P46985 | Probable alpha-1,6-mannosyltransferase MNN11 (EC 2.4.1.-) (Mannan polymerase II complex MNN11 subunit) (M-Pol II subunit MNN11) | EBI-802682 | 0.35 |
| P22202 | Heat shock protein SSA4 | EBI-802717 | 0.35 |
| P32903 | Plasma membrane ATPase proteolipid 1 | EBI-802959 | 0.35 |
| P39704 | Protein ERP2 | EBI-803225 | 0.35 |
| P32843 | Mitochondrial escape protein 2 (Protein RNA12) | EBI-803607 | 0.35 |
| P0CI39 | Pheromone alpha factor receptor | EBI-803823 | 0.35 |
| Q12680 | Glutamate synthase [NADH] (EC 1.4.1.14) (NADH-GOGAT) | EBI-804008 | 0.35 |
| P22215 | Uncharacterized transporter SLY41 | EBI-804242 | 0.35 |
| Q03771 | Assembly chaperone of RPL4 | EBI-804362 | 0.35 |
| Q04305 | U3 small nucleolar RNA-associated protein 15 (U3 snoRNA-associated protein 15) (U three protein 15) (U3 protein 15 required for transcription) (t-UTP15) | EBI-804878 | 0.35 |
| P39969 | Protein BOI2 (Protein BEB1) | EBI-805048 | 0.35 |
| P40035 | Mitochondrial phosphate carrier protein 2 (Phosphate transport protein 2) (PTP 2) (Pi carrier isoform 2) (mPic 2) | EBI-805054 | 0.35 |
| Q12296 | Protein MAM3 | EBI-805165 | 0.35 |
| P40970 | Serine palmitoyltransferase 2 (SPT 2) (EC 2.3.1.50) (Long chain base biosynthesis protein 2) | EBI-805812 | 0.35 |
| P38264 | SRP-independent targeting protein 3 (Inorganic phosphate transport protein PHO88) (Phosphate metabolism protein PHO88) | EBI-806188 | 0.35 |
| P39676 | Flavohemoprotein (EC 1.14.12.17) (Flavohemoglobin) (Hemoglobin-like protein) (Nitric oxide dioxygenase) (NO oxygenase) (NOD) | EBI-806418 | 0.35 |
| P25360 | Inorganic phosphate transporter PHO87 | EBI-806544 | 0.35 |
| P35200 | Protein UPS2, mitochondrial (Altered inheritance rate of mitochondrion protein 30) (Genetic interactor of prohibitins protein 1) (Unprocessed MGM1 protein 2) | EBI-806623 | 0.35 |
| P39004 | High-affinity hexose transporter HXT7 | EBI-806863 | 0.35 |
| P40319 | Elongation of fatty acids protein 3 (EC 2.3.1.199) (3-keto acyl-CoA synthase ELO3) (Affecting plasma membrane ATPase activity protein 1) (Suppressor of RAD3 essential function protein 1) (Suppressor of Rvs161 and Rvs167 mutations protein 4) (Very-long-chain 3-oxoacyl-CoA synthase 3) (v-SNARE bypass mutant gene 1 protein) | EBI-807008 | 0.35 |
| P32340 | Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial (EC 1.6.5.9) (Internal NADH dehydrogenase) (NADH:ubiquinone reductase (non-electrogenic)) | EBI-807081 | 0.35 |
| P39715 | Shuttling pre-60S factor ECM1 (Extracellular mutant protein 1) (Protein SIM1) | EBI-807214 | 0.35 |
| P07246 | Alcohol dehydrogenase 3, mitochondrial (EC 1.1.1.1) (Alcohol dehydrogenase III) (YADH-3) | EBI-807320 | 0.35 |
| Q05881 | Uncharacterized protein YLR287C | EBI-807421 | 0.35 |
| P32502 | Translation initiation factor eIF-2B subunit beta (GCD complex subunit GCD7) (Guanine nucleotide exchange factor subunit GCD7) (eIF-2B GDP-GTP exchange factor subunit beta) | EBI-807537 | 0.35 |
| Q12449 | Hsp90 co-chaperone AHA1 (Activator of Hsp90 ATPase protein 1) | EBI-807743 | 0.44 |
| P25454 | DNA repair protein RAD51 | EBI-807992 | 0.35 |
| P21304 | Periodic tryptophan protein 1 | EBI-808083 | 0.35 |
| P46956 | Inorganic phosphate transporter PHO86 | EBI-808284 | 0.53 |
| P13663 | Aspartate-semialdehyde dehydrogenase (ASA dehydrogenase) (ASADH) (EC 1.2.1.11) (Aspartate-beta-semialdehyde dehydrogenase) | EBI-808333 | 0.35 |
| Q04062 | 26S proteasome regulatory subunit RPN9 (Proteasome non-ATPase subunit 7) | EBI-808625 | 0.35 |
| P27929 | 37S ribosomal protein NAM9, mitochondrial (Mitochondrial small ribosomal subunit protein uS4m) (Nuclear accommodation of mitochondria protein 9) | EBI-808974 | 0.35 |
| P38689 | Ribose-phosphate pyrophosphokinase 3 (EC 2.7.6.1) (Phosphoribosyl pyrophosphate synthase 3) | EBI-809021 | 0.35 |
| P40081 | Putative magnesium-dependent phosphatase YER134C (EC 3.1.3.48) | EBI-809045 | 0.35 |
| P51998 | 54S ribosomal protein YmL6, mitochondrial (Mitochondrial large ribosomal subunit protein uL4m) | EBI-809221 | 0.35 |
| P04451 | 60S ribosomal protein L23-A (L17a) (Large ribosomal subunit protein uL14-A) (YL32) | EBI-809374 | 0.35 |
| Q03529 | Ceramide very long chain fatty acid hydroxylase SCS7 (Ceramide VLCFA hydroxylase SCS7) (4-hydroxysphinganine ceramide fatty acyl 2-hydroxylase SCS7) (EC 1.14.18.6) (Dihydroceramide fatty acyl 2-hydroxylase SCS7) (EC 1.14.18.7) (Sphingolipid alpha-hydroxylase) (Suppressor of calcium sensitivity 7) | EBI-810338 | 0.35 |
| P32492 | Myosin-4 (SWI5-dependent HO expression protein 1) | EBI-810383 | 0.35 |
| P38706 | 60S ribosomal protein L27-A (Large ribosomal subunit protein eL27-A) | EBI-810484 | 0.35 |
| P41805 | 60S ribosomal protein L10 (L9) (Large ribosomal subunit protein uL16) (Ubiquinol-cytochrome C reductase complex subunit VI-requiring protein) | EBI-810484 | 0.35 |
| P40010 | Nuclear GTP-binding protein NUG1 (Nuclear GTPase 1) | EBI-810484 | 0.35 |
| P25605 | Acetolactate synthase small subunit, mitochondrial (Acetohydroxy-acid synthase small subunit) (AHAS) (ALS) | EBI-810484 | 0.35 |
| P28241 | Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial (EC 1.1.1.41) (Isocitric dehydrogenase) (NAD(+)-specific ICDH) | EBI-810484 | 0.35 |
| Q12159 | RNA annealing protein YRA1 | EBI-810484 | 0.53 |
| P07259 | Protein URA2 [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)] | EBI-810484 | 0.35 |
| P10081 | ATP-dependent RNA helicase eIF4A (EC 3.6.4.13) (Eukaryotic initiation factor 4A) (eIF-4A) (Stimulator factor I 37 kDa component) (Translation initiation factor 1/2) (p37) | EBI-810484 | 0.56 |
| P02994 | Elongation factor 1-alpha (EF-1-alpha) (Eukaryotic elongation factor 1A) (eEF1A) (Translation elongation factor 1A) | EBI-810484 | 0.35 |
| P40150 | Ribosome-associated molecular chaperone SSB2 (EC 3.6.4.10) (Heat shock protein SSB2) (Hsp70 chaperone Ssb) | EBI-810484 | 0.35 |
| P11484 | Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb) | EBI-810484 | 0.53 |
| P10592 | Heat shock protein SSA2 | EBI-810484 | 0.35 |
| Q12464 | RuvB-like protein 2 (RUVBL2) (EC 3.6.4.12) (TIP49-homology protein 2) (TIP49b homolog) | EBI-810484 | 0.35 |
| P26783 | 40S ribosomal protein S5 (RP14) (S2) (Small ribosomal subunit protein uS7) (YS8) | EBI-810484 | 0.53 |
| P05753 | 40S ribosomal protein S4-B (RP5) (S7) (Small ribosomal subunit protein eS4-B) (YS6) | EBI-810484 | 0.35 |
| P23248 | 40S ribosomal protein S1-B (RP10B) (Small ribosomal subunit protein eS1-B) | EBI-810484 | 0.53 |
| P33442 | 40S ribosomal protein S1-A (RP10A) (Small ribosomal subunit protein eS1-A) | EBI-810484 | 0.53 |
| P35271 | 40S ribosomal protein S18-A (Small ribosomal subunit protein uS13-A) | EBI-810484 | 0.35 |
| P26781 | 40S ribosomal protein S11-A (RP41) (S18) (Small ribosomal subunit protein uS17-A) (YS12) | EBI-810484 | 0.35 |
| P32566 | Cell wall assembly regulator SMI1 (Killer toxin-resistance protein 4) | EBI-811327 | 0.35 |
| P39011 | GTPase-GDP dissociation stimulator BEM4 (Bud emergence protein 4) | EBI-811463 | 0.35 |
| P19262 | Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (OGDC-E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) | EBI-812031 | 0.35 |
| Q06338 | Protein BCP1 | EBI-812996 | 0.27 |
| P18239 | ADP,ATP carrier protein 2 (ADP/ATP translocase 2) (Adenine nucleotide translocator 2) (ANT 2) (Petite colonies protein 9) | EBI-816585 | 0.51 |
| P54115 | Magnesium-activated aldehyde dehydrogenase, cytosolic (EC 1.2.1.-) (EC 1.2.1.4) (Mg(2+)-activated acetaldehyde dehydrogenase) (Mg(2+)-ACDH) | EBI-819644 | 0.27 |
| P36046 | Mitochondrial intermembrane space import and assembly protein 40 (Mitochondrial import inner membrane translocase TIM40) | EBI-853469 | 0.35 |
| Q02776 | Mitochondrial import inner membrane translocase subunit TIM50 | EBI-853768 | 0.35 |
| P47077 | Nucleolar protein 9 (Pumilio domain-containing protein NOP9) | EBI-854045 | 0.35 |
| P47026 | GPI-anchored wall transfer protein 1 (EC 2.3.-.-) | EBI-854100 | 0.35 |
| P0CG63 | Polyubiquitin [Cleaved into: Ubiquitin] | EBI-7480729 | 0.44 |
| A0A023PZH5 | Putative uncharacterized membrane protein YMR290W-A | EBI-7178717 | 0.40 |
| P53921 | 54S ribosomal protein bL35m (Mitochondrial large ribosomal subunit protein bL35m) | EBI-7182619 | 0.40 |
| Q08204 | Structural maintenance of chromosomes protein 5 | EBI-7707649 | 0.40 |
| P38789 | Ribosome biogenesis protein SSF1 | EBI-7763954 | 0.40 |
| P36100 | Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) | EBI-7778406 | 0.40 |
| Q05050 | Eisosome protein 1 | EBI-8090720 | 0.40 |
| P38692 | Serine/threonine-protein kinase KIC1 (EC 2.7.11.1) (Kinase that interacts with CDC31) (N-rich kinase 1) | EBI-2610613 | 0.35 |
| P32790 | Actin cytoskeleton-regulatory complex protein SLA1 | EBI-7513567 | 0.37 |
| P61830 | Histone H3 | EBI-2884222 | 0.00 |
| P04912 | Histone H2A.2 | EBI-2884694 | 0.00 |
| Q12692 | Histone H2A.Z | EBI-2885248 | 0.00 |
| Q12529 | Potential protein lysine methyltransferase SET6 (EC 2.1.1.-) (SET domain-containing protein 6) | EBI-2887496 | 0.00 |
| Q04477 | Kinetochore protein SPC24 | EBI-2887856 | 0.00 |
| P46675 | Protein STU2 (Suppressor of tubulin 2) | EBI-2888241 | 0.00 |
| P40340 | ATPase histone chaperone YTA7 (EC 3.6.1.-) (ATPase family AAA domain-containing protein YTA7) (AAA-ATPase) (Tat-binding homolog 7) | EBI-2889086 | 0.00 |
| P52919 | NAP1-binding protein | EBI-7042905 | 0.63 |
| B5VKC0 | Endoplasmic reticulum junction formation protein lunapark | EBI-7043141 | 0.35 |
| P0CX39 | 40S ribosomal protein S8-A (RP19) (S14) (Small ribosomal subunit protein eS8-A) (YS9) | EBI-7043141 | 0.35 |
| P23641 | Mitochondrial phosphate carrier protein (Mitochondrial import receptor) (Phosphate transport protein) (PTP) (mPic 1) (p32) [Cleaved into: Mitochondrial phosphate carrier protein, N-terminally processed] | EBI-7043141 | 0.35 |
| P32332 | Mitochondrial oxaloacetate transport protein (Mitochondrial carrier protein PMT) | EBI-7043141 | 0.35 |
| P39926 | Protein SSO2 | EBI-7043141 | 0.35 |
| P38555 | GTP-binding protein YPT31/YPT8 (Rab GTPase YPT31) | EBI-7043141 | 0.35 |
| P21560 | Protein CBP3, mitochondrial | EBI-7043141 | 0.35 |
| P17076 | 60S ribosomal protein L8-A (L4) (L4-2) (L7a-1) (Large ribosomal subunit protein eL8-A) (Maintenance of killer protein 7) (RP6) (YL5) | EBI-7043141 | 0.35 |
| P25294 | Protein SIS1 | EBI-7043141 | 0.35 |
| P18238 | ADP,ATP carrier protein 3 (ADP/ATP translocase 3) (Adenine nucleotide translocator 3) (ANT 3) | EBI-7043141 | 0.35 |
| P47124 | Putative glycosyltransferase HOC1 (EC 2.4.-.-) (M-Pol II subunit Hoc1p) (Mannan polymerase II complex HOC1 subunit) | EBI-7043141 | 0.35 |
| P00359 | Glyceraldehyde-3-phosphate dehydrogenase 3 (GAPDH 3) (EC 1.2.1.12) | EBI-7043141 | 0.35 |
| P38130 | Probable mannosyltransferase KTR3 (EC 2.4.1.-) | EBI-7043141 | 0.35 |
| Q04947 | Reticulon-like protein 1 | EBI-7043141 | 0.35 |
| Q12690 | 60S ribosomal protein L13-A (Large ribosomal subunit protein eL13-A) | EBI-7043141 | 0.35 |
| P25087 | Sterol 24-C-methyltransferase ERG6 (SCMT) (EC 2.1.1.41) (Delta(24)-sterol C-methyltransferase ERG6) (Ergosterol biosynthetic protein 6) | EBI-7043141 | 0.35 |
| P32835 | GTP-binding nuclear protein GSP1/CNR1 (Chromosome stability protein 17) (GTPase Ran homolog) (Genetic suppressor of PRP20-1) | EBI-6472517 | 0.44 |
| P10591 | Heat shock protein SSA1 (Heat shock protein YG100) | EBI-6556984 | 0.35 |
| P38316 | Ubiquitin-like protein ATG12 (Autophagy-related protein 12) | EBI-16263556 | 0.35 |
| Q00776 | AP-1 complex subunit mu-1-I (Clathrin assembly protein complex 1 mu-1-I medium chain) (Clathrin coat assembly protein AP54) (Clathrin coat-associated protein AP54) (Golgi adaptor AP-1 54 kDa protein) (HA1 54 kDa subunit) (Mu(1)-adaptin) (Mu1-I-adaptin) | EBI-16263794 | 0.35 |
| P38153 | AP-3 complex subunit mu (AP-3 adaptor complex mu3A subunit) (Adaptor-related protein complex 3 subunit mu) (Mu-adaptin 3A) (Mu3-adaptin) | EBI-16263895 | 0.35 |
| Q00684 | Tyrosine-protein phosphatase CDC14 (EC 3.1.3.48) | EBI-16265633 | 0.35 |
| P27636 | Cell division control protein 15 (EC 2.7.11.1) | EBI-16265722 | 0.35 |
| P32562 | Cell cycle serine/threonine-protein kinase CDC5/MSD2 (EC 2.7.11.21) | EBI-16266124 | 0.35 |
| P32601 | Protein DSS4 | EBI-16268457 | 0.35 |
| P22696 | Peptidyl-prolyl cis-trans isomerase ESS1 (PPIase ESS1) (EC 5.2.1.8) (Parvulin ESS1) (Processing/termination factor 1) | EBI-16268890 | 0.35 |
| P06774 | Transcriptional activator HAP2 | EBI-16270452 | 0.35 |
| Q08273 | RING-box protein HRT1 (RING-box protein 1) (E3 ubiquitin-protein ligase complex SCF subunit HRT1) (High level expression reduces Ty3 transposition protein 1) (Regulator of cullins protein 1) | EBI-16271112 | 0.35 |
| P42838 | Alkylphosphocholine resistance protein LEM3 (Brefeldin-A sensitivity protein 3) (Ro-sensitive 3) | EBI-16272625 | 0.35 |
| P23748 | M-phase inducer phosphatase (EC 3.1.3.48) (Mitosis initiation protein MIH1) (Mitotic inducer homolog) | EBI-16273845 | 0.35 |
| Q04149 | Crossover junction endonuclease MUS81 (EC 3.1.22.-) (MMS and UV-sensitive protein 81) | EBI-16274423 | 0.35 |
| P27801 | Vacuolar membrane protein PEP3 (Carboxypeptidase Y-deficient protein 3) (Vacuolar morphogenesis protein 8) (Vacuolar protein sorting-associated protein 18) (Vacuolar protein-targeting protein 18) | EBI-16275426 | 0.35 |
| Q12223 | DNA repair protein RAD59 | EBI-16278796 | 0.35 |
| P40348 | Replication factor C subunit 2 (Replication factor C2) (Activator 1 41 kDa subunit) | EBI-16279429 | 0.35 |
| P25343 | Reduced viability upon starvation protein 161 | EBI-16281060 | 0.35 |
| P08458 | Sporulation-specific protein 1 (EC 2.7.11.1) | EBI-16283853 | 0.35 |
| P06245 | cAMP-dependent protein kinase type 2 (PKA 2) (EC 2.7.11.11) | EBI-16285493 | 0.35 |
| P33296 | Ubiquitin-conjugating enzyme E2 6 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme 6) (Ubiquitin carrier protein UBC6) (Ubiquitin-protein ligase UBC6) | EBI-16286005 | 0.35 |
| Q06668 | Methyltransferase OMS1, mitochondrial (EC 2.1.1.-) (OXA1 multicopy suppressor 1) | EBI-16288187 | 0.35 |
| P53243 | Zinc finger protein YGR067C | EBI-16289027 | 0.35 |
| P38885 | Altered inheritance of mitochondria protein 46, mitochondrial (Found in mitochondrial proteome protein 34) | EBI-16289603 | 0.35 |
| Q04437 | ATP-dependent DNA helicase II subunit 2 (EC 3.6.4.12) (ATP-dependent DNA helicase II subunit Ku80) (High affinity DNA-binding factor subunit 2) (Yeast Ku80) | EBI-16290301 | 0.35 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory