Dematin - Homo sapiens

Dematin (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Dematin
Accession Code	Q08495
Gene	DMTN
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 405)
MERLQKQPLTSPGSVSPSRDSSVPGSPSSIVAKMDNQVLGYKDLAAIPKDKAILDIERPDLMIYEPHFTYSLLEHVELPR SRERSLSPKSTSPPPSPEVWADSRSPGIISQASAPRTTGTPRTSLPHFHHPETSRPDSNIYKKPPIYKQRESVGGSPQTK HLIEDLIIESSKFPAAQPPDPNQPAKIETDYWPCPPSLAVVETEWRKRKASRRGAEEEEEEEDDDSGEEMKALRERQREE LSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSLHQGTSKSSSLPAYGRTTLSRLQSTEFSPSGSETGSPGLQN GEGQRGRMDRGNSLPCVLEQKIYPYEMLVVTNKGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKK KASLF

Structure Viewer (PDB: 1QZP)

Subcellular Location

Description
Cytoplasm. Cytoplasm, cytosol. Cytoplasm, perinuclear region {By Similarity}. Cytoplasm, cytoskeleton. Cell membrane. Membrane {By Similarity}. Endomembrane system. Cell projection {By Similarity}. Note=Localized at the spectrin-actin junction of erythrocyte plasma membrane. Localized to intracellular membranes and the cytoskeletal network. Localized at intracellular membrane-bounded organelle compartment in platelets that likely represent the dense tubular network membrane. Detected at the cell membrane and at the parasitophorous vacuole in malaria-infected erythrocytes at late stages of plasmodium berghei or falciparum development.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Actin Cytoskeleton (GO:0015629) Actin Filament (GO:0005884) Cell Projection Membrane (GO:0031253) Cortical Cytoskeleton (GO:0030863) Cytoplasmic Vesicle (GO:0031410) Cytosol (GO:0005829) Endomembrane System (GO:0012505) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Platelet Dense Tubular Network Membrane (GO:0031095) Postsynaptic Density (GO:0014069) Spectrin-Associated Cytoskeleton (GO:0014731)

Biology & Function

Description
Membrane-cytoskeleton-associated protein with F-actin-binding activity that induces F-actin bundles formation and stabilization. Its F-actin-bundling activity is reversibly regulated upon its phosphorylation by the cAMP-dependent protein kinase A (PKA). Binds to the erythrocyte membrane glucose transporter-1 SLC2A1/GLUT1, and hence stabilizes and attaches the spectrin-actin network to the erythrocytic plasma membrane. Plays a role in maintaining the functional integrity of PKA-activated erythrocyte shape and the membrane mechanical properties. Also plays a role as a modulator of actin dynamics in fibroblasts; acts as a negative regulator of the RhoA activation pathway. In platelets, functions as a regulator of internal calcium mobilization across the dense tubular system that affects platelet granule secretion pathways and aggregation. Also required for the formation of a diverse set of cell protrusions, such as filopodia and lamellipodia, necessary for platelet cell spreading, motility and migration. Acts as a tumor suppressor and inhibits malignant cell transformation. {Experimental EvidencePubMed:10565303, Experimental EvidencePubMed:11856323, Experimental EvidencePubMed:18347014, Experimental EvidencePubMed:19241372, Experimental EvidencePubMed:22927433, Experimental EvidencePubMed:23355471}.
Assigned Ontology terms

Biological Process	Actin Cytoskeleton Organization (GO:0030036) Actin Filament Bundle Assembly (GO:0051017) Actin Filament Capping (GO:0051693) Actin Filament Reorganization (GO:0090527) Calcium-Mediated Signaling Using Extracellular Calcium Source (GO:0035585) Calcium-Mediated Signaling Using Intracellular Calcium Source (GO:0035584) Cellular Response To Calcium Ion (GO:0071277) Cellular Response To CAMP (GO:0071320) Cytoskeleton Organization (GO:0007010) Erythrocyte Development (GO:0048821) Lamellipodium Assembly (GO:0030032) Negative Regulation Of Cell-Substrate Adhesion (GO:0010812) Negative Regulation Of Focal Adhesion Assembly (GO:0051895) Negative Regulation Of Peptidyl-Serine Phosphorylation (GO:0033137) Negative Regulation Of Peptidyl-Threonine Phosphorylation (GO:0010801) Negative Regulation Of Peptidyl-Tyrosine Phosphorylation (GO:0050732) Negative Regulation Of Protein Targeting To Membrane (GO:0090315) Negative Regulation Of Substrate Adhesion-Dependent Cell Spreading (GO:1900025) Positive Regulation Of Blood Coagulation (GO:0030194) Positive Regulation Of Fibroblast Migration (GO:0010763) Positive Regulation Of Integrin-Mediated Signaling Pathway (GO:2001046) Positive Regulation Of Platelet Aggregation (GO:1901731) Positive Regulation Of Substrate Adhesion-Dependent Cell Spreading (GO:1900026) Positive Regulation Of Wound Healing (GO:0090303) Protein Secretion By Platelet (GO:0070560) Protein-Containing Complex Assembly (GO:0065003) Regulation Of Actin Cytoskeleton Organization (GO:0032956) Regulation Of Cell Shape (GO:0008360) Regulation Of Filopodium Assembly (GO:0051489) Regulation Of Lamellipodium Assembly (GO:0010591)
Molecular Function	Actin Binding (GO:0003779) Actin Filament Binding (GO:0051015) Protein Self-Association (GO:0043621) Signaling Receptor Binding (GO:0005102) Spectrin Binding (GO:0030507)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q86YD1	Prostate tumor-overexpressed gene 1 protein	EBI-735504	0.00
Interactions with other proteins (16 interactors)

Partner (UniProt)		IntAct	Confidence score
O43237	Cytoplasmic dynein 1 light intermediate chain 2 (Dynein light intermediate chain 2, cytosolic) (LIC-2) (LIC53/55)	EBI-731827	0.00
Q9UNN8	Endothelial protein C receptor (Activated protein C receptor) (APC receptor) (Endothelial cell protein C receptor) (CD antigen CD201)	EBI-734445	0.00
P62316	Small nuclear ribonucleoprotein Sm D2 (Sm-D2) (snRNP core protein D2)	EBI-736673	0.00
P31946	14-3-3 protein beta/alpha (Protein 1054) (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein beta/alpha, N-terminally processed]	EBI-8796749	0.35
P14618	Pyruvate kinase PKM (EC 2.7.1.40) (Cytosolic thyroid hormone-binding protein) (CTHBP) (Opa-interacting protein 3) (OIP-3) (Pyruvate kinase 2/3) (Pyruvate kinase muscle isozyme) (Threonine-protein kinase PKM2) (EC 2.7.11.1) (Thyroid hormone-binding protein 1) (THBP1) (Tumor M2-PK) (Tyrosine-protein kinase PKM2) (EC 2.7.10.2) (p58)	EBI-9355736	0.44
Q08379	Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95)	EBI-10225555	0.56
Q8TAP6	Centrosomal protein of 76 kDa (Cep76)	EBI-24382670	0.56
Q8IYF3	Testis-expressed protein 11 (Protein ZIP4 homolog) (ZIP4H)	EBI-24387259	0.56
Q12933	TNF receptor-associated factor 2 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF2) (RING-type E3 ubiquitin transferase TRAF2) (Tumor necrosis factor type 2 receptor-associated protein 3)	EBI-24472525	0.56
Q8IWV7	E3 ubiquitin-protein ligase UBR1 (EC 2.3.2.27) (N-recognin-1) (RING-type E3 ubiquitin transferase UBR1) (Ubiquitin-protein ligase E3-alpha-1) (Ubiquitin-protein ligase E3-alpha-I)	EBI-21864310	0.35
Q86TI2	Dipeptidyl peptidase 9 (DP9) (EC 3.4.14.5) (Dipeptidyl peptidase IV-related protein 2) (DPRP-2) (Dipeptidyl peptidase IX) (DPP IX) (Dipeptidyl peptidase-like protein 9) (DPLP9)	EBI-21864310	0.35
P63104	14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1)	EBI-21864310	0.35
P62258	14-3-3 protein epsilon (14-3-3E)	EBI-21864310	0.35
P61981	14-3-3 protein gamma (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein gamma, N-terminally processed]	EBI-21864310	0.35
Q04917	14-3-3 protein eta (Protein AS1)	EBI-21907689	0.35
P50552	Vasodilator-stimulated phosphoprotein (VASP)	EBI-30845230	0.44

Cross-References

Database	Links
UNIPROT	Q08495 A8K0T5 B3KP70 B3KRH3 B4DI75 E9PEJ0 Q13215 Q9BRE3
PDB	1QZP 1ZV6
Pfam	PF16182 PF02209
PROSITE	PS51089
OMIM	125305
DisGeNET	2039

Dematin (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 1QZP)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Interactions with other proteins (16 interactors)

Cross-References

Database

Links

Description

Description