Protein Information |
|
|---|---|
| Protein Name | RRP12-like protein |
| Accession Code | Q5JTH9 |
| Gene | RRP12 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 1297) | |
|
MGRSGKLPSGVSAKLKRWKKGHSSDSNPAICRHRQAARSRFFSRPSGRSDLTVDAVKLHNELQSGSLRLGKSEAPETPMEEEAELVLTEKSSGTFLSGLSDCTNVTFSKVQRFWESNSAAHKEICAVLAA VTEVIRSQGGKETETEYFAALMTTMEAVESPESLAAVAYLLNLVLKRVPSPVLIKKFSDTSKAFMDIMSAQASSGSTSVLRWVLSCLATLLRKQDLEAWGYPVTLQVYHGLLSFTVHPKPKIRKAAQHGV CSVLKGSEFMFEKAPAHHPAAISTAKFCIQEIEKSGGSKEATTTLHMLTLLKDLLPCFPEGLVKSCSETLLRVMTLSHVLVTACAMQAFHSLFHARPGLSTLSAELNAQIITALYDYVPSENDLQPLLAW LKVMEKAHINLVRLQWDLGLGHLPRFFGTAVTCLLSPHSQVLTAATQSLKEILKECVAPHMADIGSVTSSASGPAQSVAKMFRAVEEGLTYKFHAAWSSVLQLLCVFFEACGRQAHPVMRKCLQSLCDLR LSPHFPHTAALDQAVGAAVTSMGPEVVLQAVPLEIDGSEETLDFPRSWLLPVIRDHVQETRLGFFTTYFLPLANTLKSKAMDLAQAGSTVESKIYDTLQWQMWTLLPGFCTRPTDVAISFKGLARTLGMA ISERPDLRVTVCQALRTLITKGCQAEADRAEVSRFAKNFLPILFNLYGQPVAAGDTPAPRRAVLETIRTYLTITDTQLVNSLLEKASEKVLDPASSDFTRLSVLDLVVALAPCADEAAISKLYSTIRPYL ESKAHGVQKKAYRVLEEVCASPQGPGALFVQSHLEDLKKTLLDSLRSTSSPAKRPRLKCLLHIVRKLSAEHKEFITALIPEVILCTKEVSVGARKNAFALLVEMGHAFLRFGSNQEEALQCYLVLIYPGL VGAVTMVSCSILALTHLLFEFKGLMGTSTVEQLLENVCLLLASRTRDVVKSALGFIKVAVTVMDVAHLAKHVQLVMEAIGKLSDDMRRHFRMKLRNLFTKFIRKFGFELVKRLLPEEYHRVLVNIRKAEA RAKRHRALSQAAVEEEEEEEEEEEPAQGKGDSIEEILADSEDEEDNEEEERSRGKEQRKLARQRSRAWLKEGGGDEPLNFLDPKVAQRVLATQPGPGRGRKKDHGFKVSADGRLIIREEADGNKMEEEEG AKGEDEEMADPMEDVIIRNKKHQKLKHQKEAEEEELEIPPQYQAGGSGIHRPVAKKAMPGAEYKAKKAKGDVKKKGRPDPYAYIPLNRSKLNRRKKMKLQGQFKGLVKAARRGSQVGHKNRRKDRRP |
|
Description |
||
|---|---|---|
| Nucleus, nucleolus {Experimental EvidencePubMed:12429849}. Nucleus membrane {Curator Inference}; Single-pass membrane protein {Curator Inference}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Nuclear Envelope | SL-0178 | The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space. |
| Nuclear Membrane | SL-0182 | The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane. | Membrane Topology |
| Topology | Source | Annotation Type |
| Transmembrane | UniProt | Sequence Analysis {ECO:0000255} | Assigned Ontology terms |
| Cellular Component | Cytosol (GO:0005829) Intracellular Membrane-Bounded Organelle (GO:0043231) Nuclear Membrane (GO:0031965) Nucleolus (GO:0005730) Plasma Membrane (GO:0005886) |
|
Description |
|
|---|---|
Assigned Ontology terms |
|
| Biological Process | RRNA Processing (GO:0006364) |
| Molecular Function | RNA Binding (GO:0003723) |
Interactions with Nuclear Envelope proteins (4 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| O95271 | Poly [ADP-ribose] polymerase tankyrase-1 | EBI-30838215 | 0.44 |
| Q92905 | COP9 signalosome complex subunit 5 | EBI-21325777 | 0.35 |
| Q7L5N1 | COP9 signalosome complex subunit 6 | EBI-21328549 | 0.35 |
| A0A142I5B9 | RNA-directed RNA polymerase NS5 | EBI-20625330 | 0.35 | Interactions with other proteins (89 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q96CW1 | AP-2 complex subunit mu (AP-2 mu chain) (Adaptin-mu2) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (HA2 50 kDa subunit) (Plasma membrane adaptor AP-2 50 kDa protein) | EBI-311571 | 0.37 |
| Q99558 | Mitogen-activated protein kinase kinase kinase 14 (EC 2.7.11.25) (NF-kappa-beta-inducing kinase) (HsNIK) (Serine/threonine-protein kinase NIK) | EBI-363073 | 0.00 |
| Q9NY93 | Probable ATP-dependent RNA helicase DDX56 (EC 3.6.4.13) (ATP-dependent 61 kDa nucleolar RNA helicase) (DEAD box protein 21) (DEAD box protein 56) | EBI-1075899 | 0.00 |
| Q9JMK2 | Casein kinase I isoform epsilon (CKI-epsilon) (CKIe) (EC 2.7.11.1) | EBI-2558429 | 0.40 |
| P62960 | Y-box-binding protein 1 (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (DNA-binding protein B) (DBPB) (Enhancer factor I subunit A) (EFI-A) (Nuclease-sensitive element-binding protein 1) (Y-box transcription factor) | EBI-2560211 | 0.40 |
| P01100 | Protein c-Fos (Cellular oncogene fos) (Fos proto-oncogene, AP-1 transcription factor subunit) (G0/G1 switch regulatory protein 7) (Proto-oncogene c-Fos) (Transcription factor AP-1 subunit c-Fos) | EBI-2688688 | 0.00 |
| P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-2877710 | 0.60 |
| Q92731 | Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2) | EBI-2880211 | 0.46 |
| P68400 | Casein kinase II subunit alpha (CK II alpha) (EC 2.7.11.1) | EBI-5294760 | 0.44 |
| Q86VP6 | Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1) (TBP-interacting protein of 120 kDa A) (TBP-interacting protein 120A) (p120 CAND1) | EBI-21322532 | 0.35 |
| Q13616 | Cullin-1 (CUL-1) | EBI-21323857 | 0.35 |
| Q13618 | Cullin-3 (CUL-3) | EBI-21329068 | 0.35 |
| Q96DB2 | Histone deacetylase 11 (HD11) (EC 3.5.1.98) | EBI-6598272 | 0.35 |
| Q16666 | Gamma-interferon-inducible protein 16 (Ifi-16) (Interferon-inducible myeloid differentiation transcriptional activator) | EBI-9995438 | 0.35 |
| P41218 | Myeloid cell nuclear differentiation antigen | EBI-9996028 | 0.35 |
| P05412 | Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39) | EBI-11323169 | 0.35 |
| Q6ZWV7 | 60S ribosomal protein L35 | EBI-10997876 | 0.35 |
| Q99661 | Kinesin-like protein KIF2C (Kinesin-like protein 6) (Mitotic centromere-associated kinesin) (MCAK) | EBI-11004229 | 0.35 |
| P27635 | 60S ribosomal protein L10 (Laminin receptor homolog) (Large ribosomal subunit protein uL16) (Protein QM) (Ribosomal protein L10) (Tumor suppressor QM) | EBI-11035646 | 0.35 |
| F8VQC1 | Signal recognition particle subunit SRP72 | EBI-11054725 | 0.35 |
| O00567 | Nucleolar protein 56 (Nucleolar protein 5A) | EBI-11069711 | 0.35 |
| Q00839 | Heterogeneous nuclear ribonucleoprotein U (hnRNP U) (GRIP120) (Nuclear p120 ribonucleoprotein) (Scaffold-attachment factor A) (SAF-A) (p120) (pp120) | EBI-11088773 | 0.35 |
| F8VQC7 | Kinectin | EBI-11104527 | 0.35 |
| P06748 | Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) | EBI-11145880 | 0.35 |
| Q9QZD9 | Eukaryotic translation initiation factor 3 subunit I (eIF3i) (Eukaryotic translation initiation factor 3 subunit 2) (TGF-beta receptor-interacting protein 1) (TRIP-1) (eIF-3-beta) (eIF3 p36) | EBI-11149349 | 0.35 |
| P56180 | Putative tyrosine-protein phosphatase TPTE (EC 3.1.3.48) (Cancer/testis antigen 44) (CT44) (Transmembrane phosphatase with tensin homology) (Tumor antigen BJ-HCC-5) | EBI-14025693 | 0.42 |
| Q96KR7 | Phosphatase and actin regulator 3 (Scaffold-associated PP1-inhibiting protein) (Scapinin) | EBI-14027299 | 0.35 |
| Q8IVT5 | Kinase suppressor of Ras 1 (EC 2.7.11.1) | EBI-14035664 | 0.35 |
| P11487 | Fibroblast growth factor 3 (FGF-3) (Heparin-binding growth factor 3) (HBGF-3) (Proto-oncogene Int-2) | EBI-21532550 | 0.35 |
| Q6AW86 | Zinc finger protein 324B | EBI-21553112 | 0.35 |
| P22492 | Histone H1t (Testicular H1 histone) | EBI-21580683 | 0.35 |
| O43159 | Ribosomal RNA-processing protein 8 (EC 2.1.1.-) (Cerebral protein 1) (Nucleomethylin) | EBI-21627620 | 0.35 |
| P55075 | Fibroblast growth factor 8 (FGF-8) (Androgen-induced growth factor) (AIGF) (Heparin-binding growth factor 8) (HBGF-8) | EBI-21635166 | 0.35 |
| P10412 | Histone H1.4 (Histone H1b) (Histone H1s-4) | EBI-21665473 | 0.35 |
| Q8WYQ3 | Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial (Protein N27C7-4) | EBI-21674595 | 0.35 |
| P15880 | 40S ribosomal protein S2 (40S ribosomal protein S4) (Protein LLRep3) (Small ribosomal subunit protein uS5) | EBI-21677299 | 0.35 |
| Q15020 | Squamous cell carcinoma antigen recognized by T-cells 3 (SART-3) (Tat-interacting protein of 110 kDa) (Tip110) (p110 nuclear RNA-binding protein) | EBI-21678189 | 0.35 |
| Q5T3I0 | G patch domain-containing protein 4 | EBI-21681508 | 0.35 |
| Q8N0W7 | FMR1 neighbor protein (Cancer/testis antigen 37) (CT37) (Sarcoma antigen NY-SAR-35) | EBI-21682168 | 0.35 |
| O14836 | Tumor necrosis factor receptor superfamily member 13B (Transmembrane activator and CAML interactor) (CD antigen CD267) | EBI-21700334 | 0.35 |
| P19438 | Tumor necrosis factor receptor superfamily member 1A (Tumor necrosis factor receptor 1) (TNF-R1) (Tumor necrosis factor receptor type I) (TNF-RI) (TNFR-I) (p55) (p60) (CD antigen CD120a) [Cleaved into: Tumor necrosis factor receptor superfamily member 1A, membrane form; Tumor necrosis factor-binding protein 1 (TBPI)] | EBI-21717945 | 0.35 |
| Q96HE9 | Proline-rich protein 11 | EBI-21733724 | 0.35 |
| Q9NY72 | Sodium channel subunit beta-3 | EBI-21735451 | 0.35 |
| P62263 | 40S ribosomal protein S14 (Small ribosomal subunit protein uS11) | EBI-21741976 | 0.35 |
| Q02539 | Histone H1.1 (Histone H1a) | EBI-21742951 | 0.35 |
| Q9BYG3 | MKI67 FHA domain-interacting nucleolar phosphoprotein (Nucleolar phosphoprotein Nopp34) (Nucleolar protein interacting with the FHA domain of pKI-67) (hNIFK) | EBI-21743958 | 0.35 |
| P18124 | 60S ribosomal protein L7 (Large ribosomal subunit protein uL30) | EBI-21745402 | 0.35 |
| P01127 | Platelet-derived growth factor subunit B (PDGF subunit B) (PDGF-2) (Platelet-derived growth factor B chain) (Platelet-derived growth factor beta polypeptide) (Proto-oncogene c-Sis) (Becaplermin) | EBI-21779861 | 0.35 |
| Q13895 | Bystin | EBI-21815267 | 0.35 |
| Q2NL82 | Pre-rRNA-processing protein TSR1 homolog | EBI-21815364 | 0.35 |
| Q86VZ2 | WD repeat-containing protein 5B | EBI-21853663 | 0.35 |
| Q14684 | Ribosomal RNA processing protein 1 homolog B (RRP1-like protein B) | EBI-16686997 | 0.35 |
| Q9NWT8 | Aurora kinase A-interacting protein (AURKA-interacting protein) (28S ribosomal protein S38, mitochondrial) (MRP-S38) (Mitochondrial small ribosomal subunit protein mS38) | EBI-16786806 | 0.27 |
| Q96GD4 | Aurora kinase B (EC 2.7.11.1) (Aurora 1) (Aurora- and IPL1-like midbody-associated protein 1) (AIM-1) (Aurora/IPL1-related kinase 2) (ARK-2) (Aurora-related kinase 2) (STK-1) (Serine/threonine-protein kinase 12) (Serine/threonine-protein kinase 5) (Serine/threonine-protein kinase aurora-B) | EBI-16787973 | 0.27 |
| O15155 | BET1 homolog (hBET1) (Golgi vesicular membrane-trafficking protein p18) | EBI-16788067 | 0.27 |
| P22087 | rRNA 2'-O-methyltransferase fibrillarin (EC 2.1.1.-) (34 kDa nucleolar scleroderma antigen) (Histone-glutamine methyltransferase) (U6 snRNA 2'-O-methyltransferase fibrillarin) | EBI-16792282 | 0.42 |
| P68431 | Histone H3.1 (Histone H3/a) (Histone H3/b) (Histone H3/c) (Histone H3/d) (Histone H3/f) (Histone H3/h) (Histone H3/i) (Histone H3/j) (Histone H3/k) (Histone H3/l) | EBI-16793336 | 0.42 |
| P62491 | Ras-related protein Rab-11A (Rab-11) (EC 3.6.5.2) (YL8) | EBI-16797971 | 0.27 |
| P51151 | Ras-related protein Rab-9A | EBI-16798325 | 0.27 |
| P62753 | 40S ribosomal protein S6 (Phosphoprotein NP33) (Small ribosomal subunit protein eS6) | EBI-16798663 | 0.42 |
| O43493 | Trans-Golgi network integral membrane protein 2 (Trans-Golgi network glycoprotein 46) (TGN38 homolog) (hTGN46) (Trans-Golgi network glycoprotein 48) (hTGN48) (Trans-Golgi network glycoprotein 51) (hTGN51) (Trans-Golgi network protein 2) | EBI-16800265 | 0.27 |
| P27824 | Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90) | EBI-16789004 | 0.42 |
| Q15075 | Early endosome antigen 1 (Endosome-associated protein p162) (Zinc finger FYVE domain-containing protein 2) | EBI-16791787 | 0.27 |
| Q08379 | Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95) | EBI-16793089 | 0.27 |
| Q7KZN9 | Cytochrome c oxidase assembly protein COX15 homolog | EBI-20304305 | 0.35 |
| P14404 | Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog) | EBI-21028244 | 0.35 |
| F5H1C8 | Solute carrier family 15 member 3 (Solute carrier family 15, member 3, isoform CRA_a) | EBI-21264930 | 0.35 |
| P12004 | Proliferating cell nuclear antigen (PCNA) (Cyclin) | EBI-21255178 | 0.37 |
| Q9ULX6 | A-kinase anchor protein 8-like (AKAP8-like protein) (Helicase A-binding protein 95) (HAP95) (Homologous to AKAP95 protein) (HA95) (Neighbor of A-kinase-anchoring protein 95) (Neighbor of AKAP95) | EBI-26451653 | 0.35 |
| P35226 | Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51) | EBI-27109494 | 0.35 |
| P11274 | Breakpoint cluster region protein (EC 2.7.11.1) (Renal carcinoma antigen NY-REN-26) | EBI-28931791 | 0.35 |
| P11801 | Serine/threonine-protein kinase H1 (EC 2.7.11.1) (Protein serine kinase H1) (PSK-H1) | EBI-28931861 | 0.35 |
| P43405 | Tyrosine-protein kinase SYK (EC 2.7.10.2) (Spleen tyrosine kinase) (p72-Syk) | EBI-28935283 | 0.35 |
| P78362 | SRSF protein kinase 2 (EC 2.7.11.1) (SFRS protein kinase 2) (Serine/arginine-rich protein-specific kinase 2) (SR-protein-specific kinase 2) [Cleaved into: SRSF protein kinase 2 N-terminal; SRSF protein kinase 2 C-terminal] | EBI-28948274 | 0.35 |
| Q9Y2H9 | Microtubule-associated serine/threonine-protein kinase 1 (EC 2.7.11.1) (Syntrophin-associated serine/threonine-protein kinase) | EBI-28948459 | 0.35 |
| Q9H5K3 | Protein O-mannose kinase (POMK) (EC 2.7.1.183) (Protein kinase-like protein SgK196) (Sugen kinase 196) | EBI-28948637 | 0.35 |
| O60729 | Dual specificity protein phosphatase CDC14B (EC 3.1.3.16) (EC 3.1.3.48) (CDC14 cell division cycle 14 homolog B) | EBI-27115568 | 0.27 |
| Q9UIH9 | Krueppel-like factor 15 (Kidney-enriched krueppel-like factor) | EBI-29019642 | 0.35 |
| Q9BXK1 | Krueppel-like factor 16 (Basic transcription element-binding protein 4) (BTE-binding protein 4) (Novel Sp1-like zinc finger transcription factor 2) (Transcription factor BTEB4) (Transcription factor NSLP2) | EBI-29019783 | 0.42 |
| O43474 | Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor) | EBI-29020028 | 0.35 |
| O95600 | Krueppel-like factor 8 (Basic krueppel-like factor 3) (Zinc finger protein 741) | EBI-29020196 | 0.35 |
| P31314 | T-cell leukemia homeobox protein 1 (Homeobox protein Hox-11) (Proto-oncogene TCL-3) (T-cell leukemia/lymphoma protein 3) | EBI-29607649 | 0.35 |
| P50458 | LIM/homeobox protein Lhx2 (Homeobox protein LH-2) (LIM homeobox protein 2) | EBI-29019155 | 0.27 |
| P01106 | Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) | EBI-29661630 | 0.27 |
| P48431 | Transcription factor SOX-2 | EBI-29721059 | 0.27 |
| O43763 | T-cell leukemia homeobox protein 2 (Homeobox protein Hox-11L1) (Neural crest homeobox protein) | EBI-29786140 | 0.27 |
| P30530 | Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (AXL oncogene) | EBI-32719959 | 0.27 |
| P21709 | Ephrin type-A receptor 1 (hEpha1) (EC 2.7.10.1) (EPH tyrosine kinase) (EPH tyrosine kinase 1) (Erythropoietin-producing hepatoma receptor) (Tyrosine-protein kinase receptor EPH) | EBI-32720516 | 0.27 |
| P36888 | Receptor-type tyrosine-protein kinase FLT3 (EC 2.7.10.1) (FL cytokine receptor) (Fetal liver kinase-2) (FLK-2) (Fms-like tyrosine kinase 3) (FLT-3) (Stem cell tyrosine kinase 1) (STK-1) (CD antigen CD135) | EBI-32722567 | 0.27 |
Database | Links |
| UNIPROT | Q5JTH9 B4DK00 E9PCK7 Q5JTH8 Q69YK4 Q96E87 Q9BUH3 Q9Y4C7 |
| Pfam | PF08161 |
| OMIM | 617723 |
| DisGeNET | 23223 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory