NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Bcl-2-like protein 1 - Mus musculus - NucEnvDB

Bcl-2-like protein 1 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Bcl-2-like protein 1
Accession Code	Q64373
Gene	Bcl2l1
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 233)
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ VLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK

Structure Viewer (PDB: 4YK9)

Subcellular Location

Description
Mitochondrion membrane {Experimental EvidencePubMed:7607090}; Single-pass membrane protein {Experimental EvidencePubMed:7607090}. Nucleus membrane {ECO:0000250}; Single- pass membrane protein {ECO:0000250}; Cytoplasmic side {ECO:0000250}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {Experimental EvidencePubMed:7607090}. Note=Localizes to the centrosome when phosphorylated at Ser-49. [Isoform Bcl-X(L)]: Mitochondrion inner membrane. Mitochondrion outer membrane. Mitochondrion matrix {ECO:0000250}. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane {ECO:0000250}. Cytoplasm, cytosol {ECO:0000250}. Note=After neuronal stimulation, translocates from cytosol to synaptic vesicle and mitochondrion membrane in a calmodulin-dependent manner. {ECO:0000250}. [Isoform Bcl-X(delta-TM)]: Cytoplasm.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Anchoring Junction (GO:0070161) Bcl-2 Family Protein Complex (GO:0097136) Centrosome (GO:0005813) Clathrin-Coated Pit (GO:0005905) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Endoplasmic Reticulum (GO:0005783) Membrane (GO:0016020) Mitochondrial Envelope (GO:0005740) Mitochondrial Inner Membrane (GO:0005743) Mitochondrial Matrix (GO:0005759) Mitochondrial Membrane (GO:0031966) Mitochondrial Outer Membrane (GO:0005741) Mitochondrion (GO:0005739) Nuclear Membrane (GO:0031965) Presynapse (GO:0098793) PUMA-BCL-Xl Complex (GO:0097143) Synaptic Vesicle Membrane (GO:0030672)

Biology & Function

Description
Potent inhibitor of cell death. Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage- dependent anion channel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochondrial membrane. Also acts as a regulator of G2 checkpoint and progression to cytokinesis during mitosis. {Experimental EvidencePubMed:9390687}. Isoform Bcl-X(L) also regulates presynaptic plasticity, including neurotransmitter release and recovery, number of axonal mitochondria as well as size and number of synaptic vesicle clusters. During synaptic stimulation, increases ATP availability from mitochondria through regulation of mitochondrial membrane ATP synthase F(1)F(0) activity and regulates endocytic vesicle retrieval in hippocampal neurons through association with DMN1L and stimulation of its GTPase activity in synaptic vesicles (By similarity). May attenuate inflammation impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release (By similarity). {By Similarity, By Similarity\|UniProtKB:Q07817}. Isoform Bcl-X(S) promotes apoptosis. {By Similarity}.
Assigned Ontology terms

Biological Process	Apoptotic Process (GO:0006915) Apoptotic Process In Bone Marrow Cell (GO:0071839) Cellular Response To Alkaloid (GO:0071312) Cellular Response To Amino Acid Stimulus (GO:0071230) Cellular Response To Gamma Radiation (GO:0071480) Defense Response To Virus (GO:0051607) Dendritic Cell Apoptotic Process (GO:0097048) Dendritic Cell Proliferation (GO:0044565) Ectopic Germ Cell Programmed Cell Death (GO:0035234) Epithelial Cell Proliferation (GO:0050673) Extrinsic Apoptotic Signaling Pathway In Absence Of Ligand (GO:0097192) Fertilization (GO:0009566) Germ Cell Development (GO:0007281) Hepatocyte Apoptotic Process (GO:0097284) In Utero Embryonic Development (GO:0001701) Intrinsic Apoptotic Signaling Pathway In Response To DNA Damage (GO:0008630) Male Gonad Development (GO:0008584) Mitochondrion Morphogenesis (GO:0070584) Negative Regulation Of Anoikis (GO:2000811) Negative Regulation Of Apoptotic Process (GO:0043066) Negative Regulation Of Dendritic Cell Apoptotic Process (GO:2000669) Negative Regulation Of Developmental Process (GO:0051093) Negative Regulation Of Endoplasmic Reticulum Stress-Induced Intrinsic Apoptotic Signaling Pathway (GO:1902236) Negative Regulation Of Execution Phase Of Apoptosis (GO:1900118) Negative Regulation Of Extrinsic Apoptotic Signaling Pathway Via Death Domain Receptors (GO:1902042) Negative Regulation Of Intrinsic Apoptotic Signaling Pathway (GO:2001243) Negative Regulation Of Intrinsic Apoptotic Signaling Pathway In Response To DNA Damage (GO:1902230) Negative Regulation Of Mitochondrial Outer Membrane Permeabilization Involved In Apoptotic Signaling Pathway (GO:1901029) Negative Regulation Of Neuron Apoptotic Process (GO:0043524) Negative Regulation Of Protein Localization To Plasma Membrane (GO:1903077) Negative Regulation Of Release Of Cytochrome C From Mitochondria (GO:0090201) Negative Regulation Of Reproductive Process (GO:2000242) Neuron Apoptotic Process (GO:0051402) Ovarian Follicle Development (GO:0001541) Positive Regulation Of Apoptotic Process (GO:0043065) Positive Regulation Of ATP Biosynthetic Process (GO:2001171) Positive Regulation Of Mononuclear Cell Proliferation (GO:0032946) Positive Regulation Of Synaptic Vesicle Clustering (GO:2000809) Positive Regulation Of Synaptic Vesicle Endocytosis (GO:1900244) Positive Regulation Of Synaptic Vesicle Exocytosis (GO:2000302) Regulation Of Apoptotic Process (GO:0042981) Regulation Of Cytokinesis (GO:0032465) Regulation Of Growth (GO:0040008) Regulation Of Long-Term Synaptic Depression (GO:1900452) Regulation Of Mitochondrial Membrane Permeability (GO:0046902) Regulation Of Mitochondrial Membrane Potential (GO:0051881) Release Of Cytochrome C From Mitochondria (GO:0001836) Response To Cycloheximide (GO:0046898) Response To Cytokine (GO:0034097) Response To Ischemia (GO:0002931) Response To Radiation (GO:0009314) Response To Virus (GO:0009615) Spermatogenesis (GO:0007283) Suppression By Virus Of Host Apoptotic Process (GO:0019050) Synaptic Vesicle Recycling Via Endosome (GO:0036466)
Molecular Function	BH Domain Binding (GO:0051400) BH3 Domain Binding (GO:0051434) Clathrin Binding (GO:0030276) Cysteine-Type Endopeptidase Inhibitor Activity Involved In Apoptotic Process (GO:0043027) GTPase Binding (GO:0051020) Identical Protein Binding (GO:0042802) MDM2/MDM4 Family Protein Binding (GO:0097371) Protein Heterodimerization Activity (GO:0046982) Protein Homodimerization Activity (GO:0042803) Protein Kinase Binding (GO:0019901) Protein-Containing Complex Binding (GO:0044877)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q07817	Bcl-2-like protein 1	EBI-700869	0.40
Interactions with other proteins (8 interactors)

Partner (UniProt)		IntAct	Confidence score
Q99ML1	Bcl-2-binding component 3 (p53 up-regulated modulator of apoptosis)	EBI-727813	0.35
P02340	Cellular tumor antigen p53 (Tumor suppressor p53)	EBI-727813	0.35
O54918	Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death)	EBI-1037127	0.44
P63087	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit)	EBI-1202891	0.00
O54926	Apoptosis regulatory protein Siva (CD27-binding protein) (CD27BP)	EBI-1393194	0.40
O00198	Activator of apoptosis harakiri (BH3-interacting domain-containing protein 3) (Neuronal death protein DP5)	EBI-6375860	0.40
Q61337	Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)	EBI-6693214	0.40
P59637	Envelope small membrane protein (E protein) (sM protein)	EBI-25487713	0.40

Cross-References

Database	Links
UNIPROT	Q64373 O35844 Q60657 Q60658 Q61338
PDB	1PQ0 1PQ1 2BZW 3IHC 3IHD 3IHE 3IHF 3IIG 3IIH 3ILB 3ILC 4YJ4 4YK9 5C3G
Pfam	PF00452 PF02180
PROSITE	PS50062 PS01080 PS01258 PS01259 PS01260 PS50063

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK