Macoilin - Homo sapiens

Macoilin (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Macoilin
Accession Code	Q8N5G2
Gene	MACO1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 664)
MKRRNADCSKLRRPLKRNRITEGIYGSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVFFVCVAFTSNIICLLFIPIQWLFFAASTYVWVQYVWHTERGVCLPTVSLWIL FVYIEAAIRFKDLKNFHVDLCRPFAAHCIGYPVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQQMLQKQEKEAEEAAKGLPDMDSSILIHHNGGIPANKKLSTTLPEIEYREKGKEKD KDAKKHNLGINNNNILQPVDSKIQEIEYMENHINSKRLNNDLVGSTENLLKEDSCTASSKNYKNASGVVNSSPRSHSATNGSIPSSSSKNEKKQKCTSKSPSTHKDLMENCIPNNQLSKPDALVRLEQDI KKLKADLQASRQVEQELRSQISSLSSTERGIRSEMGQLRQENELLQNKLHNAVQMKQKDKQNISQLEKKLKAEQEARSFVEKQLMEEKKRKKLEEATAARAVAFAAASRGECTETLRNRIRELEAEGKKL TMDMKVKEDQIRELELKVQELRKYKENEKDTEVLMSALSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQILQKDQEIKDLKQKIAEVMAVMPSITYSAATSPLSPVSPHYSSKFVETSPS GLDPNASVYQPLKK

Subcellular Location

Description
Nucleus membrane {By SimilarityUniProtKB:Q7TQE6}; Multi-pass membrane protein {Sequence Analysis}. Cell projection, axon {By SimilarityUniProtKB:Q7TQE6}. Rough endoplasmic reticulum membrane {ECO:0000269\|PubMed:21589894}; Multi-pass membrane protein {Sequence Analysis}. Note=Detected in the nucleus membrane of non-neuronal cells and in axonal outgrowths of neuronal cells. {By SimilarityUniProtKB:Q7TQE6}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Axon (GO:0030424) Neuron Projection Terminus (GO:0044306) Nuclear Membrane (GO:0031965) Nucleus (GO:0005634) Rough Endoplasmic Reticulum Membrane (GO:0030867) Synapse (GO:0045202)

Biology & Function

Description
Plays a role in the regulation of neuronal activity. {Experimental EvidencePubMed:21589894}.
Assigned Ontology terms

Biological Process	Brain Development (GO:0007420) Chemotaxis (GO:0006935) Neuronal Signal Transduction (GO:0023041)
Molecular Function	Microtubule Binding (GO:0008017)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q91B85	RNA-directed RNA polymerase NS5	EBI-11423711	0.37
Interactions with other proteins (54 interactors)

Partner (UniProt)		IntAct	Confidence score
O15198	Mothers against decapentaplegic homolog 9 (MAD homolog 9) (Mothers against DPP homolog 9) (Madh6) (SMAD family member 9) (SMAD 9) (Smad9)	EBI-7259624	0.37
P28702	Retinoic acid receptor RXR-beta (Nuclear receptor subfamily 2 group B member 2) (Retinoid X receptor beta)	EBI-2683504	0.00
A0A6L7HPH6	TrmB family transcriptional regulator	EBI-2830137	0.00
A0A6L7H2Q9	MutT/nudix family protein	EBI-2830118	0.00
P42858	Huntingtin (Huntington disease protein) (HD protein) [Cleaved into: Huntingtin, myristoylated N-terminal fragment]	EBI-9051540	0.37
E9QKK1	Centromere-associated protein E	EBI-10995761	0.35
P35278	Ras-related protein Rab-5C (EC 3.6.5.2)	EBI-11012136	0.35
Q80SY4	E3 ubiquitin-protein ligase MIB1 (EC 2.3.2.27) (DAPK-interacting protein 1) (DIP-1) (Mind bomb homolog 1) (RING-type E3 ubiquitin transferase MIB1)	EBI-11073706	0.35
F8VQC7	Kinectin	EBI-11104527	0.35
Q969M3	Protein YIPF5 (Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5) (Smooth muscle cell-associated protein 5) (SMAP-5) (YIP1 family member 5) (YPT-interacting protein 1 A)	EBI-11127233	0.35
O00400	Acetyl-coenzyme A transporter 1 (AT-1) (Acetyl-CoA transporter 1) (Solute carrier family 33 member 1)	EBI-11135399	0.35
Q86UK5	Limbin (Ellis-van Creveld syndrome protein 2) (EVC2)	EBI-11372136	0.27
Q96Q45	Transmembrane protein 237 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein)	EBI-11396533	0.27
Q9P0N5	Transmembrane protein 216	EBI-11398030	0.27
Q6L8G8	Keratin-associated protein 5-7 (Keratin-associated protein 5-3) (Keratin-associated protein 5.3) (Keratin-associated protein 5.7) (Ultrahigh sulfur keratin-associated protein 5.7)	EBI-24291548	0.56
Q9UGL9	Cysteine-rich C-terminal protein 1 (Protein NICE-1)	EBI-24305412	0.56
Q5T752	Late cornified envelope protein 1D (Late envelope protein 4)	EBI-24309004	0.56
Q701N4	Keratin-associated protein 5-2 (Keratin-associated protein 5-8) (Keratin-associated protein 5.2) (Keratin-associated protein 5.8) (Ultrahigh sulfur keratin-associated protein 5.2)	EBI-24310314	0.56
P0DPK4	Notch homolog 2 N-terminal-like protein C	EBI-24351641	0.56
Q92570	Nuclear receptor subfamily 4 group A member 3 (Mitogen-induced nuclear orphan receptor) (Neuron-derived orphan receptor 1) (Nuclear hormone receptor NOR-1)	EBI-25248670	0.56
P48745	CCN family member 3 (Cellular communication network factor 3) (Insulin-like growth factor-binding protein 9) (IBP-9) (IGF-binding protein 9) (IGFBP-9) (Nephro blastoma-overexpressed gene protein homolog) (Protein NOV homolog) (NovH)	EBI-22746356	0.56
Q5T754	Late cornified envelope protein 1F (Late envelope protein 6)	EBI-24520187	0.56
Q5TA76	Late cornified envelope protein 3A (Late envelope protein 13)	EBI-24531368	0.56
P49901	Sperm mitochondrial-associated cysteine-rich protein	EBI-24625366	0.56
A0JP26	POTE ankyrin domain family member B3	EBI-23808076	0.56
Q8N720	Zinc finger protein 655 (Vav-interacting Krueppel-like protein)	EBI-24763284	0.56
A8MW99	Meiosis-specific protein MEI4	EBI-23928235	0.56
Q5T753	Late cornified envelope protein 1E (Late envelope protein 5)	EBI-24373601	0.56
Q6FHY5	MEOX2 protein	EBI-24410810	0.56
Q5TA81	Late cornified envelope protein 2C (Late envelope protein 11)	EBI-24265291	0.56
Q8WZ59	Transmembrane protein 190	EBI-24553302	0.56
Q5T5B0	Late cornified envelope protein 3E (Late envelope protein 17)	EBI-24565659	0.56
P49639	Homeobox protein Hox-A1 (Homeobox protein Hox-1F)	EBI-24568937	0.56
Q96FE5	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 (Leucine-rich repeat and immunoglobulin domain-containing protein 1) (Leucine-rich repeat neuronal protein 1) (Leucine-rich repeat neuronal protein 6A)	EBI-24583447	0.56
Q5T751	Late cornified envelope protein 1C (Late envelope protein 3)	EBI-24638348	0.56
Q9Y5I4	Protocadherin alpha-C2 (PCDH-alpha-C2)	EBI-21510892	0.35
Q16581	C3a anaphylatoxin chemotactic receptor (C3AR) (C3a-R)	EBI-21515265	0.35
P33151	Cadherin-5 (7B4 antigen) (Vascular endothelial cadherin) (VE-cadherin) (CD antigen CD144)	EBI-21650356	0.35
Q9Y5F2	Protocadherin beta-11 (PCDH-beta-11)	EBI-21658599	0.35
O43505	Beta-1,4-glucuronyltransferase 1 (EC 2.4.1.-) (I-beta-1,3-N-acetylglucosaminyltransferase) (iGnT) (N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase) (Poly-N-acetyllactosamine extension enzyme) (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1)	EBI-21751424	0.35
P27824	Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90)	EBI-16788621	0.27
Q16659	Mitogen-activated protein kinase 6 (MAP kinase 6) (MAPK 6) (EC 2.7.11.24) (Extracellular signal-regulated kinase 3) (ERK-3) (MAP kinase isoform p97) (p97-MAPK)	EBI-16814198	0.35
Q9UKM9	RNA-binding protein Raly (Autoantigen p542) (Heterogeneous nuclear ribonucleoprotein C-like 2) (hnRNP core protein C-like 2) (hnRNP associated with lethal yellow protein homolog)	EBI-20899752	0.40
P62937	Peptidyl-prolyl cis-trans isomerase A (PPIase A) (EC 5.2.1.8) (Cyclophilin A) (Cyclosporin A-binding protein) (Rotamase A) [Cleaved into: Peptidyl-prolyl cis-trans isomerase A, N-terminally processed]	EBI-20909224	0.40
Q15077	P2Y purinoceptor 6 (P2Y6)	EBI-21262943	0.35
Q5JRV8	Transmembrane protein 255A (Protein FAM70A)	EBI-21266273	0.35
Q9H1C4	Protein unc-93 homolog B1 (Unc-93B1) (hUNC93B1)	EBI-21266770	0.35
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-21301141	0.35
A6NI28	Rho GTPase-activating protein 42 (Rho GTPase-activating protein 10-like) (Rho-type GTPase-activating protein 42)	EBI-25410626	0.35
P0DOF2	Matrix protein (Phosphoprotein M2)	EBI-25603126	0.35
P0DTC5	Membrane protein (M) (E1 glycoprotein) (Matrix glycoprotein) (Membrane glycoprotein)	EBI-25685699	0.35
P59596	Membrane protein (M protein) (E1 glycoprotein) (Matrix glycoprotein) (Membrane glycoprotein)	EBI-26376514	0.35
Q92729	Receptor-type tyrosine-protein phosphatase U (R-PTP-U) (EC 3.1.3.48) (Pancreatic carcinoma phosphatase 2) (PCP-2) (Protein-tyrosine phosphatase J) (PTP-J) (hPTP-J) (Protein-tyrosine phosphatase pi) (PTP pi) (Protein-tyrosine phosphatase receptor omicron) (PTP-RO) (Receptor-type protein-tyrosine phosphatase psi) (R-PTP-psi)	EBI-27116760	0.27
Q16832	Discoidin domain-containing receptor 2 (Discoidin domain receptor 2) (EC 2.7.10.1) (CD167 antigen-like family member B) (Discoidin domain-containing receptor tyrosine kinase 2) (Neurotrophic tyrosine kinase, receptor-related 3) (Receptor protein-tyrosine kinase TKT) (Tyrosine-protein kinase TYRO10) (CD antigen CD167b)	EBI-32717626	0.35

Cross-References

Database	Links
UNIPROT	Q8N5G2 B1AK00 Q2TLX5 Q2TLX6 Q9NVG6
Pfam	PF09726
OMIM	610301
DisGeNET	55219

Macoilin (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Interactions with other proteins (54 interactors)

Cross-References

Database

Links

Description

Description