NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Phospholipid scramblase 1 - Mus musculus - NucEnvDB

Phospholipid scramblase 1 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Phospholipid scramblase 1
Accession Code	Q9JJ00
Gene	Plscr1
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 328)
MENHSKQTEAPHPGTYMPAGYPPPYPPAAFQGPSDHAAYPIPQAGYQGPPGPYPGPQPGYPVPPGGYAGGGPSGFPVQNQPAYNHPGGPGGTPWMPAPPPPLNCPPGLEYLAQIDQLLVHQQIELLEVLT GFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCCSDIDFELKSLD EESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNEEQRSGAWQ

Subcellular Location

Description
Cell membrane {By SimilarityUniProtKB:O15162}; Single-pass type II membrane protein {By SimilarityUniProtKB:O15162}. Cell membrane {By SimilarityUniProtKB:O15162}; Lipid-anchor {By SimilarityUniProtKB:O15162}; Cytoplasmic side. Nucleus {By SimilarityUniProtKB:O15162}. Cytoplasm {By SimilarityUniProtKB:O15162}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:O15162}. Note=Localizes to the perinuclear region in the presence of RELT. Palmitoylation regulates its localization to the cell membrane or the nucleus; trafficking to the cell membrane is dependent upon palmitoylation whereas in the absence of palmitoylation, localizes to the nucleus. {By SimilarityUniProtKB:O15162}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Collagen-Containing Extracellular Matrix (GO:0062023) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Golgi Apparatus (GO:0005794) Membrane Raft (GO:0045121) Nucleolus (GO:0005730) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886)

Biology & Function

Description
Catalyzes calcium-induced ATP-independent rapid bidirectional and non-specific distribution of phospholipids (lipid scrambling or lipid flip-flop) between the inner and outer leaflet of the plasma membrane resulting in collapse of the phospholipid asymmetry which leads to phosphatidylserine externalization on the cell surface (PubMed:32110987). Mediates calcium-dependent phosphatidylserine externalization and apoptosis in neurons via its association with TRPC5 (PubMed:32110987). Also exhibits magnesium-dependent nuclease activity against double-stranded DNA and RNA but not single-stranded DNA and can enhance DNA decatenation mediated by TOP2A (By similarity). Negatively regulates FcR-mediated phagocytosis in differentiated macrophages (PubMed:26745724). May contribute to cytokine-regulated cell proliferation and differentiation (PubMed:12010804). {By SimilarityUniProtKB:O15162, Experimental EvidencePubMed:12010804, Experimental EvidencePubMed:26745724, Experimental EvidencePubMed:32110987}.
Assigned Ontology terms

Biological Process	Acute-Phase Response (GO:0006953) Cellular Response To Cytokine Stimulus (GO:0071345) Cellular Response To Lipopolysaccharide (GO:0071222) Defense Response To Virus (GO:0051607) Immune Response (GO:0006955) Intrinsic Apoptotic Signaling Pathway (GO:0097193) Myeloid Cell Differentiation (GO:0030099) Negative Regulation Of Phagocytosis (GO:0050765) Negative Regulation Of Protein Binding (GO:0032091) Negative Regulation Of Viral Genome Replication (GO:0045071) Phosphatidylserine Biosynthetic Process (GO:0006659) Phosphatidylserine Exposure On Apoptotic Cell Surface (GO:0070782) Plasma Membrane Phospholipid Scrambling (GO:0017121) Positive Regulation Of Apoptotic Process (GO:0043065) Positive Regulation Of Chromosome Separation (GO:1905820) Positive Regulation Of DNA Topoisomerase (ATP-Hydrolyzing) Activity (GO:2000373) Positive Regulation Of Innate Immune Response (GO:0045089) Positive Regulation Of Intrinsic Apoptotic Signaling Pathway In Response To DNA Damage (GO:1902231) Positive Regulation Of Transcription By RNA Polymerase II (GO:0045944) Regulation Of Fc Receptor Mediated Stimulatory Signaling Pathway (GO:0060368) Regulation Of Mast Cell Activation (GO:0033003) Response To Interferon-Alpha (GO:0035455)
Molecular Function	Calcium Ion Binding (GO:0005509) CD4 Receptor Binding (GO:0042609) DNA Binding (GO:0003677) DNA-Binding Transcription Activator Activity, RNA Polymerase II-Specific (GO:0001228) Enzyme Binding (GO:0019899) Epidermal Growth Factor Receptor Binding (GO:0005154) Lead Ion Binding (GO:0032791) Magnesium Ion Binding (GO:0000287) Mercury Ion Binding (GO:0045340) Nuclease Activity (GO:0004518) Phospholipid Scramblase Activity (GO:0017128) SH3 Domain Binding (GO:0017124) Virus Receptor Activity (GO:0001618) Zinc Ion Binding (GO:0008270)

Disease associations

Description
Note=Participates in a chromosomal translocation that produces MMTRA1A which is leukemogenic to syngenic SL mice and athymic nude mice.
Database Associations
OMIM
DisGeNET

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O35626	Dexamethasone-induced Ras-related protein 1	EBI-4325299	0.37

Cross-References

Database	Links
UNIPROT	Q9JJ00 O54730 O54731 Q9D1F8
Pfam	PF03803

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK