Exocyst complex component 1 - Homo sapiens

Exocyst complex component 1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Exocyst complex component 1
Accession Code	Q9NV70
Gene	EXOC1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 894)
MTAIKHALQRDIFTPNDERLLSIVNVCKAGKKKKNCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAWALRDLAVVDAKDAIKENPEFDLHFEKIYKWVASSTAEKNAFISCIWKLNQRYLRKKIDFV NVSSQLLEESVPSGENQSVTGGDEEVVDEYQELNAREEQDIEIMMEGCEYAISNAEAFAEKLSRELQVLDGANIQSIMASEKQVNILMKLLDEALKEVDQIELKLSSYEEMLQSVKEQMDQISESNHLIH LSNTNNVKLLSEIEFLVNHMDLAKGHIKALQEGDLASSRGIEACTNAADALLQCMNVALRPGHDLLLAVKQQQQRFSDLRELFARRLASHLNNVFVQQGHDQSSTLAQHSVELTLPNHHPFHRDLLRYAK LMEWLKSTDYGKYEGLTKNYMDYLSRLYEREIKDFFEVAKIKMTGTTKESKKFATLPRKESAVKQETESLHGSSGKLTGSTSSLNKLSVQSSGNRRSQSSSLLDMGNMSASDLDVADRTKFDKIFEQVLS ELEPLCLAEQDFISKFFKLQQHQSMPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTAQNVDPASFLSTTLGNVLVTVKRNFDKC ISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFHHIFATLSRLKISCLEAEKKEAKQKYTDHLQSYVIYSLGQPLEKLNH FFEGVEARVAQGIREEEVSYQLAFNKQELRKVIKEYPGKEVKKGLDNLYKKVDKHLCEEENLLQVVWHSMQDEFIRQYKHFEGLIARCYPGSGVTMEFTIQDILDYCSSIAQSH

Subcellular Location

Description
Midbody, Midbody ring {Experimental EvidencePubMed:16213214}. Cytoplasm {Experimental EvidencePubMed:16181645, Experimental EvidencePubMed:19889084}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:19889084}. Cell membrane {Experimental EvidencePubMed:16181645}. Note=Colocalizes with CNTRL/centriolin at the midbody ring (PubMed:16213214). Localizes in cell membrane in the presence of SLC6A9 (PubMed:16181645). {Experimental EvidencePubMed:16181645, Experimental EvidencePubMed:16213214}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytoplasmic Side Of Apical Plasma Membrane (GO:0098592) Cytosol (GO:0005829) Exocyst (GO:0000145) Flemming Body (GO:0090543) Membrane (GO:0016020) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886)

Biology & Function

Description
Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane. (Microbial infection) Has an antiviral effect against flaviviruses by affecting viral RNA transcription and translation through the sequestration of elongation factor 1-alpha (EEF1A1). This results in decreased viral RNA synthesis and decreased viral protein translation. {Experimental EvidencePubMed:19889084}.
Assigned Ontology terms

Biological Process	Defense Response To Virus (GO:0051607) Exocytosis (GO:0006887) Golgi To Plasma Membrane Transport (GO:0006893) Membrane Fission (GO:0090148) Mitotic Cytokinesis (GO:0000281) Phosphatidylinositol-Mediated Signaling (GO:0048015) Positive Regulation Of Protein Secretion (GO:0050714) Protein Transport (GO:0015031) Regulation Of Macroautophagy (GO:0016241) Vesicle Docking Involved In Exocytosis (GO:0006904) Vesicle Tethering Involved In Exocytosis (GO:0090522)
Molecular Function	Phosphatidylinositol-4,5-Bisphosphate Binding (GO:0005546)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (10 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O60645	Exocyst complex component 3	EBI-12449995	0.51
O95295	SNARE-associated protein Snapin	EBI-21673234	0.35
Q12840	Kinesin heavy chain isoform 5A	EBI-21673234	0.35
Q7Z3B4	Nucleoporin p54	EBI-24426768	0.67
Q8IX03	Protein KIBRA	EBI-15812551	0.41
Q8IYI6	Exocyst complex component 8	EBI-12450194	0.51
Q8NF91	Nesprin-1	EBI-21375821	0.00
Q8TAG9	Exocyst complex component 6	EBI-12449995	0.51
Q8WXH0	Nesprin-2	EBI-21375239	0.00
Q03001	Dystonin	EBI-1105725	0.00
Interactions with other proteins (131 interactors)

Partner (UniProt)		IntAct	Confidence score
P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	EBI-1062888	0.00
Q9BZD4	Kinetochore protein Nuf2 (hNuf2) (hNuf2R) (hsNuf2) (Cell division cycle-associated protein 1)	EBI-21673234	0.35
Q5KU26	Collectin-12 (Collectin placenta protein 1) (CL-P1) (hCL-P1) (Nurse cell scavenger receptor 2) (Scavenger receptor class A member 4) (Scavenger receptor with C-type lectin)	EBI-1105596	0.00
Q9HCM1	Retroelement silencing factor 1	EBI-1105801	0.00
Q13439	Golgin subfamily A member 4 (256 kDa golgin) (Golgin-245) (Protein 72.1) (Trans-Golgi p230)	EBI-21673234	0.35
Q9H7U1	Serine-rich coiled-coil domain-containing protein 2 (Coiled-coil serine-rich protein 2) (Protein GCAP14 homolog)	EBI-1105914	0.00
Q9C0D2	Centrosomal protein of 295 kDa	EBI-1105940	0.00
Q9UPN3	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4/5 (620 kDa actin-binding protein) (ABP620) (Actin cross-linking family protein 7) (Macrophin-1) (Trabeculin-alpha)	EBI-1106060	0.00
Q9NRI5	Disrupted in schizophrenia 1 protein	EBI-1106277	0.00
Q96A65	Exocyst complex component 4 (Exocyst complex component Sec8)	EBI-12449995	0.80
O60239	SH3 domain-binding protein 5 (SH3BP-5) (SH3 domain-binding protein that preferentially associates with BTK)	EBI-1106308	0.00
Q13813	Spectrin alpha chain, non-erythrocytic 1 (Alpha-II spectrin) (Fodrin alpha chain) (Spectrin, non-erythroid alpha subunit)	EBI-1106390	0.00
Q9C026	E3 ubiquitin-protein ligase TRIM9 (EC 2.3.2.27) (RING finger protein 91) (RING-type E3 ubiquitin transferase TRIM9) (Tripartite motif-containing protein 9)	EBI-1106505	0.00
O75962	Triple functional domain protein (EC 2.7.11.1) (PTPRF-interacting protein)	EBI-1106525	0.00
Q5NH32	Dihydroxy-acid dehydratase (DAD) (EC 4.2.1.9)	EBI-2806981	0.00
Q13573	SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein)	EBI-7950968	0.35
Q80U62	Run domain Beclin-1-interacting and cysteine-rich domain-containing protein (Rubicon)	EBI-3506571	0.40
Q8CDJ3	Beclin 1-associated autophagy-related key regulator (Barkor) (Autophagy-related protein 14-like protein) (Atg14L)	EBI-3506695	0.40
Q15051	IQ calmodulin-binding motif-containing protein 1 (Nephrocystin-5) (p53 and DNA damage-regulated IQ motif protein) (PIQ)	EBI-4286917	0.64
A8K0Z3	WASH complex subunit 1 (CXYorf1-like protein on chromosome 9) (Protein FAM39E) (WAS protein family homolog 1)	EBI-9075674	0.51
Q6P5D4	Centrosomal protein of 135 kDa (Cep135) (Centrosomal protein 4)	EBI-10991106	0.35
P48039	Melatonin receptor type 1A (Mel-1A-R) (Mel1a receptor)	EBI-11578238	0.00
Q96KP1	Exocyst complex component 2 (Exocyst complex component Sec5)	EBI-12449995	0.80
O95721	Synaptosomal-associated protein 29 (SNAP-29) (Soluble 29 kDa NSF attachment protein) (Vesicle-membrane fusion protein SNAP-29)	EBI-12449995	0.51
Q13445	Transmembrane emp24 domain-containing protein 1 (Interleukin-1 receptor-like 1 ligand) (Putative T1/ST2 receptor-binding protein) (p24 family protein gamma-1) (Tp24) (p24gamma1)	EBI-12449995	0.51
Q9UEU0	Vesicle transport through interaction with t-SNAREs homolog 1B (Vesicle transport v-SNARE protein Vti1-like 1) (Vti1-rp1)	EBI-12449995	0.51
Q9UPT5	Exocyst complex component 7 (Exocyst complex component Exo70)	EBI-12449995	0.51
Q53HC9	EARP and GARP complex-interacting protein 1 (Endosome-associated recycling protein-interacting protein) (Golgi-associated retrograde protein-interacting protein) (Tumor-suppressing STF cDNA 1 protein) (Tumor-suppressing subchromosomal transferable fragment candidate gene 1 protein)	EBI-12449995	0.51
Q13049	E3 ubiquitin-protein ligase TRIM32 (EC 2.3.2.27) (72 kDa Tat-interacting protein) (RING-type E3 ubiquitin transferase TRIM32) (Tripartite motif-containing protein 32) (Zinc finger protein HT2A)	EBI-12449995	0.51
O00471	Exocyst complex component 5 (Exocyst complex component Sec10) (hSec10)	EBI-12449995	0.51
Q9H5N1	Rab GTPase-binding effector protein 2 (Rabaptin-5beta)	EBI-12449995	0.51
Q9Y2D4	Exocyst complex component 6B (Exocyst complex component Sec15B) (SEC15-like protein 2)	EBI-12450145	0.51
Q8TD31	Coiled-coil alpha-helical rod protein 1 (Alpha-helical coiled-coil rod protein) (Putative gene 8 protein) (Pg8)	EBI-24359951	0.56
P18848	Cyclic AMP-dependent transcription factor ATF-4 (cAMP-dependent transcription factor ATF-4) (Activating transcription factor 4) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (Tax-responsive enhancer element-binding protein 67) (TaxREB67)	EBI-22734600	0.56
P11234	Ras-related protein Ral-B (EC 3.6.5.2)	EBI-11934086	0.00
O36551	Glycoprotein K8.1 (Glycoprotein K8.1A) (Glycoprotein gp35/37) (K8.1) (K8.1 protein)	EBI-14062552	0.35
P35414	Apelin receptor (Angiotensin receptor-like 1) (G-protein coupled receptor APJ) (G-protein coupled receptor HG11)	EBI-21559824	0.35
Q96EV8	Dysbindin (Biogenesis of lysosome-related organelles complex 1 subunit 8) (BLOC-1 subunit 8) (Dysbindin-1) (Dystrobrevin-binding protein 1) (Hermansky-Pudlak syndrome 7 protein) (HPS7 protein)	EBI-21651992	0.35
P27930	Interleukin-1 receptor type 2 (IL-1R-2) (IL-1RT-2) (IL-1RT2) (CD121 antigen-like family member B) (CDw121b) (IL-1 type II receptor) (Interleukin-1 receptor beta) (IL-1R-beta) (Interleukin-1 receptor type II) (CD antigen CD121b) [Cleaved into: Interleukin-1 receptor type 2, membrane form (mIL-1R2) (mIL-1RII); Interleukin-1 receptor type 2, soluble form (sIL-1R2) (sIL-1RII)]	EBI-21662122	0.35
P24530	Endothelin receptor type B (ET-B) (ET-BR) (Endothelin receptor non-selective type)	EBI-21672284	0.35
O95229	ZW10 interactor (ZW10-interacting protein 1) (Zwint-1)	EBI-21673234	0.35
Q9UJ41	Rab5 GDP/GTP exchange factor (RAP1) (Rabaptin-5-associated exchange factor for Rab5) (Rabex-5)	EBI-21673234	0.35
Q9Y2X7	ARF GTPase-activating protein GIT1 (ARF GAP GIT1) (Cool-associated and tyrosine-phosphorylated protein 1) (CAT-1) (CAT1) (G protein-coupled receptor kinase-interactor 1) (GRK-interacting protein 1) (p95-APP1)	EBI-21673234	0.35
Q9UID3	Vacuolar protein sorting-associated protein 51 homolog (Another new gene 2 protein) (Protein fat-free homolog)	EBI-21673234	0.35
Q9NUP1	Biogenesis of lysosome-related organelles complex 1 subunit 4 (BLOC-1 subunit 4) (Protein cappuccino homolog)	EBI-21673234	0.35
Q9NNX1	Tuftelin	EBI-21673234	0.35
Q9BRV8	Suppressor of IKBKE 1 (Suppressor of IKK-epsilon)	EBI-21673234	0.35
Q9BQD3	KxDL motif-containing protein 1	EBI-21673234	0.35
Q96JG6	Syndetin (Coiled-coil domain-containing protein 132) (EARP/GARPII complex subunit VPS50)	EBI-21673234	0.35
Q96EK4	THAP domain-containing protein 11	EBI-21673234	0.35
Q96BD5	PHD finger protein 21A (BHC80a) (BRAF35-HDAC complex protein BHC80)	EBI-21673234	0.35
Q8TBA6	Golgin subfamily A member 5 (Cell proliferation-inducing gene 31 protein) (Golgin-84) (Protein Ret-II) (RET-fused gene 5 protein)	EBI-21673234	0.35
Q6S8J3	POTE ankyrin domain family member E (ANKRD26-like family C member 1A) (Prostate, ovary, testis-expressed protein on chromosome 2) (POTE-2)	EBI-21673234	0.35
Q6QNY1	Biogenesis of lysosome-related organelles complex 1 subunit 2 (BLOC-1 subunit 2) (Centrosome-associated protein)	EBI-21673234	0.35
Q6NZI2	Caveolae-associated protein 1 (Cavin-1) (Polymerase I and transcript release factor)	EBI-21673234	0.35
Q5VIR6	Vacuolar protein sorting-associated protein 53 homolog	EBI-21673234	0.35
Q5T1M5	FK506-binding protein 15 (FKBP-15) (133 kDa FK506-binding protein) (133 kDa FKBP) (FKBP-133) (WASP- and FKBP-like protein) (WAFL)	EBI-21673234	0.35
Q5T0U0	Coiled-coil domain-containing protein 122	EBI-21673234	0.35
Q5R372	Rab GTPase-activating protein 1-like	EBI-21673234	0.35
Q4V328	GRIP1-associated protein 1 (GRASP-1) [Cleaved into: GRASP-1 C-terminal chain (30kDa C-terminus form)]	EBI-21673234	0.35
Q16204	Coiled-coil domain-containing protein 6 (Papillary thyroid carcinoma-encoded protein) (Protein H4)	EBI-21673234	0.35
Q15276	Rab GTPase-binding effector protein 1 (Rabaptin-4) (Rabaptin-5) (Rabaptin-5alpha) (Renal carcinoma antigen NY-REN-17)	EBI-21673234	0.35
Q15025	TNFAIP3-interacting protein 1 (A20-binding inhibitor of NF-kappa-B activation 1) (ABIN-1) (HIV-1 Nef-interacting protein) (Nef-associated factor 1) (Naf1) (Nip40-1) (Virion-associated nuclear shuttling protein) (VAN) (hVAN)	EBI-21673234	0.35
Q14161	ARF GTPase-activating protein GIT2 (ARF GAP GIT2) (Cool-interacting tyrosine-phosphorylated protein 2) (CAT-2) (CAT2) (G protein-coupled receptor kinase-interactor 2) (GRK-interacting protein 2)	EBI-21673234	0.35
Q14155	Rho guanine nucleotide exchange factor 7 (Beta-Pix) (COOL-1) (PAK-interacting exchange factor beta) (p85)	EBI-21673234	0.35
Q13107	Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.4.19.12) (Deubiquitinating enzyme 4) (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Ubiquitous nuclear protein homolog)	EBI-21673234	0.35
Q13033	Striatin-3 (Cell cycle autoantigen SG2NA) (S/G2 antigen)	EBI-21673234	0.35
P33176	Kinesin-1 heavy chain (Conventional kinesin heavy chain) (Ubiquitous kinesin heavy chain) (UKHC)	EBI-21673234	0.35
P05412	Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39)	EBI-21673234	0.35
O95613	Pericentrin (Kendrin) (Pericentrin-B)	EBI-21673234	0.35
O60282	Kinesin heavy chain isoform 5C (EC 3.6.4.-) (Kinesin heavy chain neuron-specific 2) (Kinesin-1)	EBI-21673234	0.35
O43815	Striatin	EBI-21673234	0.35
O15516	Circadian locomoter output cycles protein kaput (hCLOCK) (EC 2.3.1.48) (Class E basic helix-loop-helix protein 8) (bHLHe8)	EBI-21673234	0.35
O14777	Kinetochore protein NDC80 homolog (Highly expressed in cancer protein) (Kinetochore protein Hec1) (HsHec1) (Kinetochore-associated protein 2) (Retinoblastoma-associated protein HEC)	EBI-21673234	0.35
Q9Y2V7	Conserved oligomeric Golgi complex subunit 6 (COG complex subunit 6) (Component of oligomeric Golgi complex 6)	EBI-21673529	0.35
Q9UJT2	Testis-specific serine kinase substrate (Testis-specific kinase substrate) (STK22 substrate 1)	EBI-21696311	0.35
P28908	Tumor necrosis factor receptor superfamily member 8 (CD30L receptor) (Ki-1 antigen) (Lymphocyte activation antigen CD30) (CD antigen CD30)	EBI-21750180	0.35
Q70UQ0	Inhibitor of nuclear factor kappa-B kinase-interacting protein (I kappa-B kinase-interacting protein) (IKBKB-interacting protein) (IKK-interacting protein)	EBI-21813594	0.35
Q9BT49	THAP domain-containing protein 7	EBI-21869056	0.35
Q9NPJ6	Mediator of RNA polymerase II transcription subunit 4 (Activator-recruited cofactor 36 kDa component) (ARC36) (Mediator complex subunit 4) (TRAP/SMCC/PC2 subunit p36 subunit) (Vitamin D3 receptor-interacting protein complex 36 kDa component) (DRIP36)	EBI-25472377	0.35
Q9Y275	Tumor necrosis factor ligand superfamily member 13B (B lymphocyte stimulator) (BLyS) (B-cell-activating factor) (BAFF) (Dendritic cell-derived TNF-like molecule) (TNF- and APOL-related leukocyte expressed ligand 1) (TALL-1) (CD antigen CD257) [Cleaved into: Tumor necrosis factor ligand superfamily member 13b, membrane form; Tumor necrosis factor ligand superfamily member 13b, soluble form]	EBI-21266480	0.35
Q9H1C4	Protein unc-93 homolog B1 (Unc-93B1) (hUNC93B1)	EBI-21266770	0.35
Q9UP83	Conserved oligomeric Golgi complex subunit 5 (COG complex subunit 5) (13S Golgi transport complex 90 kDa subunit) (GTC-90) (Component of oligomeric Golgi complex 5) (Golgi transport complex 1)	EBI-21370112	0.00
O14795	Protein unc-13 homolog B (Munc13-2) (munc13)	EBI-21370190	0.00
Q96RF0	Sorting nexin-18 (SH3 and PX domain-containing protein 3B)	EBI-21371429	0.00
Q86XK3	Swi5-dependent recombination DNA repair protein 1 homolog (Meiosis protein 5 homolog)	EBI-21371888	0.00
Q8TAB5	UPF0500 protein C1orf216	EBI-21372100	0.00
A0AUZ9	KAT8 regulatory NSL complex subunit 1-like protein (MSL1v2)	EBI-21372770	0.00
Q7Z6K1	THAP domain-containing protein 5	EBI-21373121	0.00
O60341	Lysine-specific histone demethylase 1A (EC 1.14.99.66) (BRAF35-HDAC complex protein BHC110) (Flavin-containing amine oxidase domain-containing protein 2) ([histone H3]-dimethyl-L-lysine(4) FAD-dependent demethylase 1A)	EBI-21374572	0.00
Q9NYJ8	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 (Mitogen-activated protein kinase kinase kinase 7-interacting protein 2) (TAK1-binding protein 2) (TAB-2) (TGF-beta-activated kinase 1-binding protein 2)	EBI-21374944	0.00
Q08AD1	Calmodulin-regulated spectrin-associated protein 2 (Calmodulin-regulated spectrin-associated protein 1-like protein 1)	EBI-21375463	0.00
O75044	SLIT-ROBO Rho GTPase-activating protein 2 (srGAP2) (Formin-binding protein 2) (Rho GTPase-activating protein 34)	EBI-21376088	0.00
O94822	E3 ubiquitin-protein ligase listerin (EC 2.3.2.27) (RING finger protein 160) (RING-type E3 ubiquitin transferase listerin) (Zinc finger protein 294)	EBI-21377108	0.00
Q9UIF3	Tektin-2 (Tektin-t) (Testicular tektin) (Testicular tektin B1-like protein) (TEKTB1) (Tektin-B1)	EBI-21377680	0.00
Q96JM3	Chromosome alignment-maintaining phosphoprotein 1 (Zinc finger protein 828)	EBI-21378253	0.00
Q8WYA0	Intraflagellar transport protein 81 homolog (Carnitine deficiency-associated protein expressed in ventricle 1) (CDV-1)	EBI-21378706	0.00
P28330	Long-chain specific acyl-CoA dehydrogenase, mitochondrial (LCAD) (EC 1.3.8.8)	EBI-21379260	0.00
Q14197	Peptidyl-tRNA hydrolase ICT1, mitochondrial (EC 3.1.1.29) (39S ribosomal protein L58, mitochondrial) (MRP-L58) (Digestion substraction 1) (DS-1) (Immature colon carcinoma transcript 1 protein) (Mitochondrial large ribosomal subunit protein mL62)	EBI-21379436	0.00
Q14571	Inositol 1,4,5-trisphosphate receptor type 2 (IP3 receptor isoform 2) (IP3R 2) (InsP3R2) (Type 2 inositol 1,4,5-trisphosphate receptor) (Type 2 InsP3 receptor)	EBI-21379754	0.00
Q6ZTA4	Tripartite motif-containing protein 67 (TRIM9-like protein)	EBI-21380545	0.00
O15230	Laminin subunit alpha-5 (Laminin-10 subunit alpha) (Laminin-11 subunit alpha) (Laminin-15 subunit alpha)	EBI-21380204	0.00
Q14980	Nuclear mitotic apparatus protein 1 (Nuclear matrix protein-22) (NMP-22) (Nuclear mitotic apparatus protein) (NuMA protein) (SP-H antigen)	EBI-21380995	0.00
Q9ULH1	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein) (ADP-ribosylation factor-directed GTPase-activating protein 1) (ARF GTPase-activating protein 1) (Development and differentiation-enhancing factor 1) (DEF-1) (Differentiation-enhancing factor 1) (PIP2-dependent ARF1 GAP)	EBI-21381430	0.00
Q9NR80	Rho guanine nucleotide exchange factor 4 (APC-stimulated guanine nucleotide exchange factor 1) (Asef) (Asef1)	EBI-21381244	0.00
Q9Y383	Putative RNA-binding protein Luc7-like 2	EBI-21381969	0.00
Q567U6	Coiled-coil domain-containing protein 93	EBI-21382571	0.00
Q5T0N5	Formin-binding protein 1-like (Transducer of Cdc42-dependent actin assembly protein 1) (Toca-1)	EBI-21382805	0.00
Q9NX95	Syntabulin (Golgi-localized syntaphilin-related protein) (Syntaxin-1-binding protein)	EBI-21383531	0.00
Q7Z4S6	Kinesin-like protein KIF21A (Kinesin-like protein KIF2) (Renal carcinoma antigen NY-REN-62)	EBI-21383490	0.00
Q3V6T2	Girdin (Akt phosphorylation enhancer) (APE) (Coiled-coil domain-containing protein 88A) (G alpha-interacting vesicle-associated protein) (GIV) (Girders of actin filament) (Hook-related protein 1) (HkRP1)	EBI-21383689	0.00
Q8WXA3	RUN and FYVE domain-containing protein 2 (Rab4-interacting protein related)	EBI-21383580	0.00
Q99459	Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein)	EBI-21383874	0.00
Q8TDR0	TRAF3-interacting protein 1 (Interleukin-13 receptor alpha 1-binding protein 1) (Intraflagellar transport protein 54 homolog) (Microtubule-interacting protein associated with TRAF3) (MIP-T3)	EBI-21383847	0.00
Q96SN8	CDK5 regulatory subunit-associated protein 2 (CDK5 activator-binding protein C48) (Centrosome-associated protein 215)	EBI-21383834	0.00
Q8N2N9	Ankyrin repeat domain-containing protein 36B (CLL-associated antigen KW-1)	EBI-21385250	0.00
Q8IYE0	Coiled-coil domain-containing protein 146	EBI-21385113	0.00
Q7Z6B7	SLIT-ROBO Rho GTPase-activating protein 1 (srGAP1) (Rho GTPase-activating protein 13)	EBI-21384976	0.00
Q49A88	Coiled-coil domain-containing protein 14	EBI-21386371	0.00
P53804	E3 ubiquitin-protein ligase TTC3 (EC 2.3.2.27) (Protein DCRR1) (RING finger protein 105) (RING-type E3 ubiquitin transferase TTC3) (TPR repeat protein D) (Tetratricopeptide repeat protein 3) (TPR repeat protein 3)	EBI-21388051	0.00
Q8IYT3	Coiled-coil domain-containing protein 170	EBI-21389251	0.00
P55197	Protein AF-10 (ALL1-fused gene from chromosome 10 protein)	EBI-21389515	0.00
Q9H2F5	Enhancer of polycomb homolog 1	EBI-21389541	0.00
Q9ULU8	Calcium-dependent secretion activator 1 (Calcium-dependent activator protein for secretion 1) (CAPS-1)	EBI-21390808	0.00
O43490	Prominin-1 (Antigen AC133) (Prominin-like protein 1) (CD antigen CD133)	EBI-21391143	0.00
P35609	Alpha-actinin-2 (Alpha-actinin skeletal muscle isoform 2) (F-actin cross-linking protein)	EBI-21391067	0.00
Q8NEY1	Neuron navigator 1 (Pore membrane and/or filament-interacting-like protein 3) (Steerin-1) (Unc-53 homolog 1) (unc53H1)	EBI-21391441	0.00
O15066	Kinesin-like protein KIF3B (HH0048) (Microtubule plus end-directed kinesin motor 3B) [Cleaved into: Kinesin-like protein KIF3B, N-terminally processed]	EBI-21392232	0.00
Q5NHH2	Hypothetical lipoprotein	EBI-22298200	0.37
Q5NGE3	Lipoprotein	EBI-22298210	0.37
O84008	Uncharacterized protein CT_005	EBI-22302433	0.35

Cross-References

Database	Links
UNIPROT	Q9NV70 Q504V4 Q8WUE7 Q96T15 Q9NZE4
Pfam	PF15277 PF09763
OMIM	607879
DisGeNET	55763

Exocyst complex component 1 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (10 interactors)

Interactions with other proteins (131 interactors)

Cross-References

Database

Links

Description

Description