NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

UBX domain-containing protein 1 - Caenorhabditis elegans - NucEnvDB

UBX domain-containing protein 1 (Caenorhabditis elegans)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	UBX domain-containing protein 1
Accession Code	Q9TXH9
Gene	ubxn
Organism	Caenorhabditis elegans (Taxonomy: 6239)
Part of Reference Proteome?	Yes
Sequence (Length: 299)
MSIAQQLMDMGFPADKAEAAAGNNRNLDQALDWIEKDGAGVPMETDAPAQAAPGAADSGAPPVAASFKCDDCGKLLANDDAIMFHASKTKHENFSESSEAIKPLTAEEKAAKVLEIREKIKVHQAKKAKL EAEENREKEKKRREDGKAMISHKEAARDREIREAAQDRRREKNEDEIARKRVLEQIRLDKEARKAKASGQPVPEAKPAPSAAPVAPPKDYSTTTLQFRLLDGQTVRQQFEANEPLAMVRAWVETNHANGV PFTLMTPFPRKVFTEDDMGTPLKVLNLVPSANVILNRAA

Subcellular Location

Description
Cytoplasm, perinuclear region {Experimental EvidencePubMed:20977550}. Note=Colocalizes with cdc-48.1 to the perinuclear region in spermatocytes. {Experimental EvidencePubMed:20977550}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Ubiquitin-binding protein which acts as an adapter for ATPase cdc-48.1 and/or cdc-48.2, conferring substrate specificity (PubMed:20977550). Together with ubxn-2 and ubxn-3, plays a role in hermaphrodite spermatogenesis probably by promoting the degradation of sex determination terminal factor tra-1. {Experimental EvidencePubMed:20977550}.
Assigned Ontology terms

Biological Process	Cell Differentiation (GO:0030154) Masculinization Of Hermaphroditic Germ-Line (GO:0042006) Negative Regulation Of Proteasomal Ubiquitin-Dependent Protein Catabolic Process (GO:0032435) Negative Regulation Of Protein K48-Linked Deubiquitination (GO:1903094) Negative Regulation Of Protein Ubiquitination (GO:0031397) Positive Regulation Of Protein Catabolic Process (GO:0045732) Spermatogenesis (GO:0007283)
Molecular Function	K48-Linked Polyubiquitin Modification-Dependent Protein Binding (GO:0036435)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P54811	Transitional endoplasmic reticulum ATPase homolog 1	EBI-2412436	0.62
Interactions with other proteins (11 interactors)

Partner (UniProt)		IntAct	Confidence score
P34327	Uncharacterized protein C13G5.2	EBI-336329	0.00
Q18157	TIL domain-containing protein	EBI-336332	0.00
Q18426	TPR_REGION domain-containing protein	EBI-336335	0.00
Q18938	Probable maleylacetoacetate isomerase (MAAI) (EC 5.2.1.2) (Glutathione S-transferase gst-42)	EBI-336341	0.00
O45521	Nuclear hormone receptor family member nhr-111	EBI-336344	0.00
P54812	Transitional endoplasmic reticulum ATPase homolog 2 (EC 3.6.4.6) (Cell division cycle-related protein 48.2) (p97/CDC48 homolog 2)	EBI-336338	0.00
Q9XUT0	DreBriN 1/DreBriN-like (Where Drebrin is from Developmentally REgulated BRaIN protein) family homolog	EBI-336347	0.00
P45972	Zinc finger transcription factor family protein 17	EBI-336350	0.00
Q23182	FBA_2 domain-containing protein	EBI-336353	0.00
Q7YTU4	Endoplasmic reticulum oxidoreductin-1 (EC 1.8.4.-)	EBI-336356	0.00
Q19019	E3 ubiquitin-protein ligase CBL (EC 2.3.2.27)	EBI-339494	0.00

Cross-References

Database	Links
UNIPROT	Q9TXH9
Pfam	PF00789
PROSITE	PS50033 PS00028

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK