Protein Information |
|
---|---|
Protein Name | MOB-like protein phocein |
Accession Code | Q9Y3A3 |
Gene | MOB4 |
Organism | Homo sapiens | Human (Taxonomy: 9606) |
Part of Reference Proteome? | Yes |
Sequence (Length: 225) | |
MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLE LNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVC RRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA |
Structure Viewer (PDB: 5YF4) |
---|
Description |
||
---|---|---|
Cytoplasm, perinuclear region {Experimental EvidencePubMed:11319234}. Membrane {Experimental EvidencePubMed:11319234}; Peripheral membrane protein {Experimental EvidencePubMed:11319234}. Golgi apparatus, Golgi stack membrane {Experimental EvidencePubMed:11319234}; Peripheral membrane protein {Experimental EvidencePubMed:11319234}. Note=In a perinuclear punctate pattern. Associated with membranes and the Golgi stacks. | Position in the Nuclear Envelope |
|
Location | Location ID | Description |
Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
Topology | Source | Annotation Type |
Peripheral | UniProt | Experimental Evidence {ECO:0000269|PubMed:11319234} | Assigned Ontology terms |
Cellular Component | Cytoplasm (GO:0005737) Cytosol (GO:0005829) Dendritic Spine (GO:0043197) Golgi Apparatus (GO:0005794) Golgi Cisterna Membrane (GO:0032580) Neuronal Cell Body (GO:0043025) Perinuclear Region Of Cytoplasm (GO:0048471) |
Description |
|
---|---|
May play a role in membrane trafficking, specifically in membrane budding reactions. {By Similarity}. | Assigned Ontology terms |
Biological Process | |
Molecular Function | Kinase Binding (GO:0019900) Metal Ion Binding (GO:0046872) |
Interactions with Nuclear Envelope proteins (4 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
Q6P5Z2 | Serine/threonine-protein kinase N3 | EBI-11918474 | 0.00 |
Q9Y4G8 | Rap guanine nucleotide exchange factor 2 | EBI-3450242 | 0.00 |
P00533 | Epidermal growth factor receptor | EBI-4397868 | 0.55 |
Q13459 | Unconventional myosin-IXb | EBI-737438 | 0.00 | Interactions with other proteins (96 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
P49736 | DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2 homolog) (Nuclear protein BM28) | EBI-730585 | 0.00 |
P22234 | Bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS) [Includes: Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) (AIR carboxylase) (AIRC); Phosphoribosylaminoimidazole succinocarboxamide synthetase (EC 6.3.2.6) (SAICAR synthetase)] | EBI-730588 | 0.00 |
Q13332 | Receptor-type tyrosine-protein phosphatase S (R-PTP-S) (EC 3.1.3.48) (Receptor-type tyrosine-protein phosphatase sigma) (R-PTP-sigma) | EBI-730591 | 0.00 |
Q5UIP0 | Telomere-associated protein RIF1 (Rap1-interacting factor 1 homolog) | EBI-730594 | 0.00 |
Q9Y3C7 | Mediator of RNA polymerase II transcription subunit 31 (Mediator complex subunit 31) (Mediator complex subunit SOH1) (hSOH1) | EBI-732941 | 0.00 |
O60383 | Growth/differentiation factor 9 (GDF-9) | EBI-732944 | 0.00 |
Q9ULH0 | Kinase D-interacting substrate of 220 kDa (Ankyrin repeat-rich membrane-spanning protein) | EBI-732947 | 0.00 |
P60660 | Myosin light polypeptide 6 (17 kDa myosin light chain) (LC17) (Myosin light chain 3) (MLC-3) (Myosin light chain alkali 3) (Myosin light chain A3) (Smooth muscle and nonmuscle myosin light chain alkali 6) | EBI-732950 | 0.00 |
Q96GD3 | Polycomb protein SCMH1 (Sex comb on midleg homolog 1) | EBI-732953 | 0.00 |
Q15047 | Histone-lysine N-methyltransferase SETDB1 (EC 2.1.1.366) (ERG-associated protein with SET domain) (ESET) (Histone H3-K9 methyltransferase 4) (H3-K9-HMTase 4) (Lysine N-methyltransferase 1E) (SET domain bifurcated 1) | EBI-732956 | 0.00 |
Q15819 | Ubiquitin-conjugating enzyme E2 variant 2 (DDVit 1) (Enterocyte differentiation-associated factor 1) (EDAF-1) (Enterocyte differentiation-promoting factor 1) (EDPF-1) (MMS2 homolog) (Vitamin D3-inducible protein) | EBI-732959 | 0.00 |
Q14194 | Dihydropyrimidinase-related protein 1 (DRP-1) (Collapsin response mediator protein 1) (CRMP-1) (Inactive dihydropyrimidinase) (Unc-33-like phosphoprotein 3) (ULIP-3) | EBI-735462 | 0.00 |
Q13158 | FAS-associated death domain protein (FAS-associating death domain-containing protein) (Growth-inhibiting gene 3 protein) (Mediator of receptor induced toxicity) | EBI-735465 | 0.00 |
Q9BTT4 | Mediator of RNA polymerase II transcription subunit 10 (Mediator complex subunit 10) (Transformation-related gene 17 protein) (TRG-17) (Transformation-related gene 20 protein) (TRG-20) | EBI-735468 | 0.00 |
Q9Y4G2 | Pleckstrin homology domain-containing family M member 1 (PH domain-containing family M member 1) (162 kDa adapter protein) (AP162) | EBI-735471 | 0.00 |
Q96KS0 | Prolyl hydroxylase EGLN2 (EC 1.14.11.-) (Egl nine homolog 2) (EC 1.14.11.29) (Estrogen-induced tag 6) (EIT-6) (HPH-3) (Hypoxia-inducible factor prolyl hydroxylase 1) (HIF-PH1) (HIF-prolyl hydroxylase 1) (HPH-1) (Prolyl hydroxylase domain-containing protein 1) (PHD1) | EBI-737429 | 0.00 |
P19419 | ETS domain-containing protein Elk-1 | EBI-737432 | 0.00 |
P23142 | Fibulin-1 (FIBL-1) | EBI-737435 | 0.00 |
Q15831 | Serine/threonine-protein kinase STK11 (EC 2.7.11.1) (Liver kinase B1) (LKB1) (hLKB1) (Renal carcinoma antigen NY-REN-19) | EBI-737441 | 0.00 |
Q8WY91 | Peroxynitrite isomerase THAP4 (EC 5.99.-.-) (Ferric Homo sapiens nitrobindin) (Hs-Nb(III)) (THAP domain-containing protein 4) | EBI-737444 | 0.00 |
O94989 | Rho guanine nucleotide exchange factor 15 (Ephexin-5) (E5) (Vsm-RhoGEF) | EBI-752704 | 0.37 |
Q15834 | Coiled-coil domain-containing protein 85B (Hepatitis delta antigen-interacting protein A) (Delta-interacting protein A) | EBI-759730 | 0.37 |
Q9Y6E0 | Serine/threonine-protein kinase 24 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 3) (MST-3) (STE20-like kinase MST3) [Cleaved into: Serine/threonine-protein kinase 24 36 kDa subunit (Mammalian STE20-like protein kinase 3 N-terminal) (MST3/N); Serine/threonine-protein kinase 24 12 kDa subunit (Mammalian STE20-like protein kinase 3 C-terminal) (MST3/C)] | EBI-2480091 | 0.74 |
Q8TDY2 | RB1-inducible coiled-coil protein 1 (FAK family kinase-interacting protein of 200 kDa) (FIP200) | EBI-1061436 | 0.00 |
Q9NZ47 | HCG1811444 (Uncharacterized hematopoietic stem/progenitor cells protein MDS027) (cDNA FLJ76545, highly similar to Homo sapiens uncharacterized hematopoietic stem/progenitor cells protein MDS027 mRNA) | EBI-1061519 | 0.00 |
Q9Y376 | Calcium-binding protein 39 (MO25alpha) (Protein Mo25) | EBI-1062295 | 0.00 |
P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | EBI-1062909 | 0.00 |
Q9Y5L4 | Mitochondrial import inner membrane translocase subunit Tim13 | EBI-1063567 | 0.00 |
Q9P031 | Thyroid transcription factor 1-associated protein 26 (TTF-1-associated protein 26) (Coiled-coil domain-containing protein 59) (TTF-1-associated protein BR2) | EBI-1070283 | 0.00 |
P23508 | Colorectal mutant cancer protein (Protein MCC) | EBI-1077095 | 0.00 |
P67775 | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform (PP2A-alpha) (EC 3.1.3.16) (Replication protein C) (RP-C) | EBI-1773521 | 0.77 |
P62714 | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PP2A-beta) (EC 3.1.3.16) | EBI-1773687 | 0.64 |
P30153 | Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (Medium tumor antigen-associated 61 kDa protein) (PP2A subunit A isoform PR65-alpha) (PP2A subunit A isoform R1-alpha) | EBI-2479208 | 0.71 |
Q59GV6 | Zinedin variant | EBI-1774238 | 0.35 |
Q9P289 | Serine/threonine-protein kinase 26 (EC 2.7.11.1) (MST3 and SOK1-related kinase) (Mammalian STE20-like protein kinase 4) (MST-4) (STE20-like kinase MST4) (Serine/threonine-protein kinase MASK) | EBI-1774238 | 0.76 |
O43815 | Striatin | EBI-2476554 | 0.74 |
P63167 | Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) | EBI-1774238 | 0.53 |
Q9ULQ0 | Striatin-interacting protein 2 (Protein FAM40B) | EBI-2479515 | 0.46 |
Q13033 | Striatin-3 (Cell cycle autoantigen SG2NA) (S/G2 antigen) | EBI-2476710 | 0.77 |
Q9NVK5 | FGFR1 oncogene partner 2 | EBI-2480091 | 0.53 |
Q5VSL9 | Striatin-interacting protein 1 (Protein FAM40A) | EBI-1774238 | 0.53 |
A8K3H8 | cDNA FLJ77680, highly similar to Homo sapiens protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform (PPP2R1A), mRNA | EBI-1774238 | 0.35 |
Q14BN4 | Sarcolemmal membrane-associated protein (Sarcolemmal-associated protein) | EBI-2479515 | 0.67 |
Q8WZ74 | Cortactin-binding protein 2 (CortBP2) | EBI-1774238 | 0.60 |
Q9P2B4 | CTTNBP2 N-terminal-like protein | EBI-1774238 | 0.73 |
Q9BRV8 | Suppressor of IKBKE 1 (Suppressor of IKK-epsilon) | EBI-2479515 | 0.60 |
Q9Y228 | TRAF3-interacting JNK-activating modulator (TRAF3-interacting protein 3) | EBI-2476666 | 0.50 |
Q9NRL3 | Striatin-4 (Zinedin) | EBI-2479446 | 0.46 |
P30154 | Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (PP2A subunit A isoform PR65-beta) (PP2A subunit A isoform R1-beta) | EBI-2479515 | 0.46 |
O55106 | Striatin | EBI-2479967 | 0.54 |
P40227 | T-complex protein 1 subunit zeta (TCP-1-zeta) (Acute morphine dependence-related protein 2) (CCT-zeta-1) (HTR3) (Tcp20) | EBI-2480091 | 0.35 |
Q9BUL8 | Programmed cell death protein 10 (Cerebral cavernous malformations 3 protein) (TF-1 cell apoptosis-related protein 15) | EBI-2480091 | 0.35 |
Q99832 | T-complex protein 1 subunit eta (TCP-1-eta) (CCT-eta) (HIV-1 Nef-interacting protein) [Cleaved into: T-complex protein 1 subunit eta, N-terminally processed] | EBI-2480091 | 0.35 |
P48643 | T-complex protein 1 subunit epsilon (TCP-1-epsilon) (CCT-epsilon) | EBI-2480091 | 0.35 |
O00506 | Serine/threonine-protein kinase 25 (EC 2.7.11.1) (Ste20-like kinase) (Sterile 20/oxidant stress-response kinase 1) (SOK-1) (Ste20/oxidant stress response kinase 1) | EBI-2480091 | 0.64 |
P17987 | T-complex protein 1 subunit alpha (TCP-1-alpha) (CCT-alpha) | EBI-2480091 | 0.35 |
Q92526 | T-complex protein 1 subunit zeta-2 (TCP-1-zeta-2) (CCT-zeta-2) (CCT-zeta-like) (TCP-1-zeta-like) (Testis-specific Tcp20) (Testis-specific protein TSA303) | EBI-2480091 | 0.35 |
P49368 | T-complex protein 1 subunit gamma (TCP-1-gamma) (CCT-gamma) (hTRiC5) | EBI-2480091 | 0.35 |
P78371 | T-complex protein 1 subunit beta (TCP-1-beta) (CCT-beta) | EBI-2480091 | 0.35 |
P50990 | T-complex protein 1 subunit theta (TCP-1-theta) (CCT-theta) (Chaperonin containing T-complex polypeptide 1 subunit 8) (Renal carcinoma antigen NY-REN-15) | EBI-2480091 | 0.35 |
Q99JT2 | Serine/threonine-protein kinase 26 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 4) (MST-4) (STE20-like kinase MST4) (Serine/threonine-protein kinase MST4) | EBI-2480319 | 0.35 |
Q9UGI0 | Ubiquitin thioesterase ZRANB1 (EC 3.4.19.12) (TRAF-binding domain-containing protein) (hTrabid) (Zinc finger Ran-binding domain-containing protein 1) | EBI-2511131 | 0.40 |
P63168 | Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) (mPIN) | EBI-2556165 | 0.40 |
Q86WH2 | Ras association domain-containing protein 3 | EBI-6912050 | 0.35 |
Q13188 | Serine/threonine-protein kinase 3 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 2) (MST-2) (STE20-like kinase MST2) (Serine/threonine-protein kinase Krs-1) [Cleaved into: Serine/threonine-protein kinase 3 36kDa subunit (MST2/N); Serine/threonine-protein kinase 3 20kDa subunit (MST2/C)] | EBI-8799700 | 0.48 |
Q13043 | Serine/threonine-protein kinase 4 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 1) (MST-1) (STE20-like kinase MST1) (Serine/threonine-protein kinase Krs-2) [Cleaved into: Serine/threonine-protein kinase 4 37kDa subunit (MST1/N); Serine/threonine-protein kinase 4 18kDa subunit (MST1/C)] | EBI-8799766 | 0.27 |
Q76MZ3 | Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (PP2A subunit A isoform PR65-alpha) (PP2A subunit A isoform R1-alpha) | EBI-10991736 | 0.35 |
P63330 | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform (PP2A-alpha) (EC 3.1.3.16) | EBI-11049240 | 0.35 |
Q91YI4 | Beta-arrestin-2 (Arrestin beta-2) | EBI-11102575 | 0.35 |
Q8C079 | Striatin-interacting protein 1 (Protein FAM40A) | EBI-11110036 | 0.35 |
Q9ERG2 | Striatin-3 (Cell cycle autoantigen SG2NA) (S/G2 antigen) | EBI-11110170 | 0.35 |
O15259 | Nephrocystin-1 (Juvenile nephronophthisis 1 protein) | EBI-11365282 | 0.27 |
Q9BPU9 | B9 domain-containing protein 2 (MKS1-related protein 2) | EBI-11377507 | 0.27 |
O95684 | Centrosomal protein 43 (FGFR1 oncogene partner) | EBI-11381827 | 0.27 |
Q15154 | Pericentriolar material 1 protein (PCM-1) (hPCM-1) | EBI-11382763 | 0.27 |
Q68CZ1 | Protein fantom (Nephrocystin-8) (RPGR-interacting protein 1-like protein) (RPGRIP1-like protein) | EBI-11386978 | 0.27 |
Q6ZU80 | Centrosomal protein of 128 kDa (Cep128) | EBI-11388429 | 0.27 |
Q86SG6 | Serine/threonine-protein kinase Nek8 (EC 2.7.11.1) (Never in mitosis A-related kinase 8) (NimA-related protein kinase 8) (Nima-related protein kinase 12a) | EBI-11389773 | 0.27 |
Q96ST8 | Centrosomal protein of 89 kDa (Cep89) (Centrosomal protein 123) (Cep123) (Coiled-coil domain-containing protein 123) | EBI-11396670 | 0.27 |
Q9C0F1 | Centrosomal protein of 44 kDa (Cep44) (HBV PreS1-transactivated protein 3) (PS1TP3) | EBI-11397104 | 0.27 |
Q9HC77 | Centromere protein J (CENP-J) (Centrosomal P4.1-associated protein) (LAG-3-associated protein) (LYST-interacting protein 1) | EBI-11397411 | 0.27 |
P40454 | Serine/threonine-protein phosphatase 2A activator 1 (EC 5.2.1.8) (Peptidyl-prolyl cis-trans isomerase PTPA-1) (PPIase PTPA-1) (Rotamase PTPA-1) (Phosphotyrosyl phosphatase activator 1) | EBI-11531126 | 0.56 |
P62195 | 26S proteasome regulatory subunit 8 (26S proteasome AAA-ATPase subunit RPT6) (Proteasome 26S subunit ATPase 5) (Proteasome subunit p45) (Thyroid hormone receptor-interacting protein 1) (TRIP1) (p45/SUG) | EBI-21656272 | 0.35 |
P19438 | Tumor necrosis factor receptor superfamily member 1A (Tumor necrosis factor receptor 1) (TNF-R1) (Tumor necrosis factor receptor type I) (TNF-RI) (TNFR-I) (p55) (p60) (CD antigen CD120a) [Cleaved into: Tumor necrosis factor receptor superfamily member 1A, membrane form; Tumor necrosis factor-binding protein 1 (TBPI)] | EBI-21717945 | 0.35 |
Q9GZV8 | PR domain zinc finger protein 14 (EC 2.1.1.-) (PR domain-containing protein 14) | EBI-21754819 | 0.35 |
P20155 | Serine protease inhibitor Kazal-type 2 (Acrosin-trypsin inhibitor) (Epididymis tissue protein Li 172) (HUSI-II) | EBI-21762493 | 0.35 |
Q9Y343 | Sorting nexin-24 | EBI-21763225 | 0.35 |
P20933 | N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase (EC 3.5.1.26) (Aspartylglucosaminidase) (Glycosylasparaginase) (N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase) [Cleaved into: Glycosylasparaginase alpha chain; Glycosylasparaginase beta chain] | EBI-21878313 | 0.35 |
Q08379 | Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95) | EBI-16792938 | 0.27 |
P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | EBI-25417249 | 0.35 |
P17813 | Endoglin (CD antigen CD105) | EBI-22197897 | 0.35 |
Q5NHT8 | Chaperone protein HtpG (Heat shock protein HtpG) (High temperature protein G) | EBI-22298716 | 0.37 |
A0A0H3LAM7 | DUF732 domain-containing protein | EBI-25401616 | 0.35 |
Q13555 | Calcium/calmodulin-dependent protein kinase type II subunit gamma (CaM kinase II subunit gamma) (CaMK-II subunit gamma) (EC 2.7.11.17) | EBI-28939534 | 0.35 |
Q8N4C8 | Misshapen-like kinase 1 (EC 2.7.11.1) (GCK family kinase MiNK) (MAPK/ERK kinase kinase kinase 6) (MEK kinase kinase 6) (MEKKK 6) (Misshapen/NIK-related kinase) (Mitogen-activated protein kinase kinase kinase kinase 6) | EBI-28943316 | 0.35 |
Q9UKE5 | TRAF2 and NCK-interacting protein kinase (EC 2.7.11.1) | EBI-28946906 | 0.35 |
Database | Links |
UNIPROT | Q9Y3A3 B4DML0 Q53SE0 Q7Z4Y6 Q9H2P3 Q9H5J1 Q9Y4T8 |
PDB | 5YF4 7K36 |
Pfam | PF03637 |
OMIM | 609361 |
DisGeNET | 25843 |