NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Stimulator of interferon genes protein - Xenopus tropicalis - NucEnvDB

Stimulator of interferon genes protein (Xenopus tropicalis)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Stimulator of interferon genes protein
Accession Code	A8E5V9
Gene	sting1
Organism	Xenopus tropicalis \| Tropical clawed frog (Taxonomy: 8364)
Part of Reference Proteome?	Yes
Sequence (Length: 329)
MACVLAIGSILFVWILGKGKYSGAQLIYRMATNFAISQGCCLVTCACELTEEIKHLHTRYNGHYWRALKASFNLSCAAFVTAILCYVFYEPKLMASLPLTIDITLTLLSWLFCWILGIQGPTPATISEIT EIKQLNVAHGLAWSYYVGYLQFVLPALKESIQKFNEENHNLLKFPETCRLHILIPLSCRLYGDLKDVDENITFLKEIPPLYIDRAGIKGRVFKNNVYRILDEDGRPYNCIVEYATPLASLLKMTDIPSAA FSADDRLQQTKLFYRTLKDILENAHELQNTYRLIVYEDFPETKDHSRHLLSQEILKHIRQQHSEEYSML

Subcellular Location

Description
Endoplasmic reticulum membrane {Experimental EvidencePubMed:30842662}; Multi-pass membrane protein {Sequence Analysis}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q86WV6}. Endoplasmic reticulum-Golgi intermediate compartment membrane {By SimilarityUniProtKB:Q86WV6}; Multi-pass membrane protein {Sequence Analysis}. Golgi apparatus membrane {By SimilarityUniProtKB:Q86WV6}; Multi-pass membrane protein {Sequence Analysis}. Cytoplasmic vesicle, autophagosome membrane {By SimilarityUniProtKB:Q86WV6}; Multi-pass membrane protein {Sequence Analysis}. Note=In response to double-stranded DNA stimulation, translocates from the endoplasmic reticulum through the endoplasmic reticulum-Golgi intermediate compartment and Golgi to post-Golgi vesicles, where the kinase tbk1 is recruited (PubMed:30842662). Upon cGAMP-binding, translocates to the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) in a process that is dependent on COPII vesicles; STING1-containing ERGIC serves as a membrane source for LC3 lipidation, which is a key step in autophagosome biogenesis (By similarity). {By SimilarityUniProtKB:Q86WV6, Experimental EvidencePubMed:30842662}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Autophagosome (GO:0005776) Autophagosome Membrane (GO:0000421) Cytoplasm (GO:0005737) Cytoplasmic Vesicle (GO:0031410) Endoplasmic Reticulum Membrane (GO:0005789) Endoplasmic Reticulum-Golgi Intermediate Compartment Membrane (GO:0033116) Golgi Membrane (GO:0000139) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Sensor of cytosolic DNA from bacteria and viruses that promotes autophagy. Acts by recognizing and binding cyclic GMP-AMP (cGAMP), a messenger produced by CGAS in response to DNA in the cytosol (PubMed:26300263, PubMed:30842662). Following cGAMP-binding, promotes the formation of autophagosomes, leading to target cytosolic DNA for degradation by the lysosome (PubMed:30842662). Exhibits guanine base- specific ligand recognition. Binds 3'-3'linked cGAMP, 2'-3' linked cGAMP and 3'-3' linked c-di-GMP with much greater affinity as compared to 3'-3' linked c-di-AMP (PubMed:26300263). Lacks the C-terminal tail (CTT) found in other vertebrate orthologs which is essential for interferon signaling (PubMed:26300263). {Experimental EvidencePubMed:26300263, Experimental EvidencePubMed:30842662}.
Assigned Ontology terms

Biological Process	Activation Of Innate Immune Response (GO:0002218) Autophagosome Assembly (GO:0000045) Defense Response To Virus (GO:0051607) Innate Immune Response (GO:0045087) Positive Regulation Of Interferon-Beta Production (GO:0032728) Positive Regulation Of Macroautophagy (GO:0016239) Positive Regulation Of Type I Interferon Production (GO:0032481) Reticulophagy (GO:0061709)
Molecular Function	2',3'-Cyclic GMP-AMP Binding (GO:0061507) Cyclic-Di-GMP Binding (GO:0035438) Protein Homodimerization Activity (GO:0042803)

Cross-References

Database	Links
UNIPROT	A8E5V9
Pfam	PF15009

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK