SWI/SNF chromatin-remodeling accessory subunit 2 - Caenorhabditis elegans

SWI/SNF chromatin-remodeling accessory subunit 2 (Caenorhabditis elegans)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	SWI/SNF chromatin-remodeling accessory subunit 2
Accession Code	O02101
Gene	swsn
Organism	Caenorhabditis elegans (Taxonomy: 6239)
Part of Reference Proteome?	Yes
Sequence (Length: 449)
MHSQQRPNPQMNRHPYGTPGSAPQMRRPGGFAGQPPQMHGPRMVAPPAAPLPKKKKYADKCIHPKIRELEPDAENYMALLASEQKLDSTLSRKKLDIQEALKRPSKVKKRLRIYISHTFIEEKQPEKDTD EASLPMWELRVEGRLLDEQPPAPAIPGQRPVPKRKFSSFFKSLVIELDKEMYGPDQHLVEWHRTPQTNETDGFQVKRAGDRPVKCRILLLLDNHPAKFKLHPRLAKVLGIATETRPKIIEALWQYIKTHG LQDPQERDIINCDTFLSQCFGVNRMRFMEVPNKLHQLLQQTDPLEFNHIIQRPKEGQEQVSTCYDIDVEMEDPVKQFMHTFVHSPGLANDIQTLDQKCYDIIEQINELKTRRDFYARFYTEPAEFIKSWV MSQNSDLKTMNELSGDLEAERFAESYVRPETEEGVQRYMFQKVNQKRHELEQSLGVRSN

Subcellular Location

Description
Nucleus, nucleoplasm {Experimental EvidencePubMed:26739451}. Chromosome {Experimental EvidencePubMed:26739451}. Nucleus envelope {Experimental EvidencePubMed:26739451}. Note=Localizes to mitotic chromosomes in the early embryo. {Experimental EvidencePubMed:26739451}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Condensed Chromosome (GO:0000793) Nuclear Envelope (GO:0005635) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) SWI/SNF Complex (GO:0016514)

Biology & Function

Description
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner (By similarity). Probably regulates vulva development through the let-60/Ras pathway (PubMed:26739451). Involved in nuclear reassembly after mitosis and recruitment of nuclear envelope protein, mel-28, to the nuclear periphery in the early embryo and in the adult germline (PubMed:26739451). Involved in gonadogenesis (PubMed:26739451, PubMed:24402584). {By SimilarityUniProtKB:Q96GM5, Experimental EvidencePubMed:24402584, Experimental EvidencePubMed:26739451}.
Assigned Ontology terms

Biological Process	Chromatin Remodeling (GO:0006338) Positive Regulation Of Double-Strand Break Repair (GO:2000781) Regulation Of G1/S Transition Of Mitotic Cell Cycle (GO:2000045) Regulation Of Mitotic Metaphase/Anaphase Transition (GO:0030071) Regulation Of Nucleotide-Excision Repair (GO:2000819) Regulation Of Transcription By RNA Polymerase II (GO:0006357)
Molecular Function	RNA Polymerase II-Specific DNA-Binding Transcription Factor Binding (GO:0061629) Transcription Coregulator Activity (GO:0003712)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q22799	Dynein light chain 1, cytoplasmic	EBI-25615276	0.35
G5EFL0	Poly(A) RNA polymerase gld-4	EBI-25616084	0.35
Q18508	Protein mel-28	EBI-25615276	0.35
Interactions with other proteins (171 interactors)

Partner (UniProt)		IntAct	Confidence score
H8ESF3	SANT domain-containing protein	EBI-6734418	0.00
C1P633	MAGI (Membrane Associated Guanylate kinase Inverted) homolog	EBI-11469543	0.37
P34255	Probable 3-ketoacyl-CoA thiolase (EC 2.3.1.16)	EBI-25615276	0.35
Q09441	SWI/SNF nucleosome remodeling complex component (ARID domain-containing protein C08B11.3)	EBI-25615276	0.35
X5M8S5	DH domain-containing protein	EBI-25615276	0.35
P46499	Uncharacterized protein F23F12.3	EBI-25615276	0.35
V6CLP5	Kettin homolog	EBI-25615276	0.35
V6CLP9	Gamma-glutamyltransferase	EBI-25615276	0.35
Q9NAA7	26S rRNA (cytosine-C(5))-methyltransferase nsun-5 (EC 2.1.1.-) (5-methylcytosine rRNA methyltransferase nsun-5) (NOL1/NOP2/Sun domain family member 5) (RNA cytosine C(5)-methyltransferase nsun-5) (rRNA cytosine C(5)-methyltransferase nsun-5)	EBI-25615276	0.35
G5ECX4	Rep_fac-A_C domain-containing protein	EBI-25615276	0.35
S6F5A3	MAGUK family	EBI-25615276	0.35
L8E833	Uncharacterized protein	EBI-25615276	0.35
G5EFE3	NLPC_P60 domain-containing protein	EBI-25615276	0.35
Q95Y48	FBA_2 domain-containing protein	EBI-25615276	0.35
G5EG14	Cactin	EBI-25615276	0.35
I2HA96	Cat eye syndrome critical region protein 5	EBI-25615276	0.35
H9G2Y6	Uncharacterized protein	EBI-25615276	0.35
Q9BL39	HMG box domain-containing protein	EBI-25615276	0.35
O45148	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (E2K)	EBI-25615276	0.35
Q9TXL4	Insulin/EGF-Receptor L Domain protein	EBI-25615276	0.35
Q19126	ATP synthase F(0) complex subunit B2, mitochondrial (ATP synthase peripheral stalk-membrane subunit B2) (ATP synthase proton-transporting mitochondrial F(0) complex subunit B2) (ATP synthase subunit B2) (ATPase subunit B2)	EBI-25615276	0.35
H2L296	Secreted protein	EBI-25615276	0.35
G5EEH6	Isovaleryl-CoA dehydrogenase, mitochondrial (EC 1.3.8.1) (EC 1.3.8.4) (Butyryl-CoA dehydrogenase)	EBI-25615276	0.35
A4F336	C2H2-type domain-containing protein	EBI-25615276	0.35
Q9N4L9	SSXT domain-containing protein	EBI-25615276	0.35
Q10021	Probable splicing factor, arginine/serine-rich 5 (CeSC35-2) (RNA-binding protein srp-3)	EBI-25615276	0.35
Q09579	Uncharacterized protein	EBI-25615276	0.35
Q9N4N4	SWI/SNF nucleosome remodeling complex component	EBI-25615276	0.35
O61834	CUTiclin-Like	EBI-25615276	0.35
O61853	KLRAQ domain-containing protein	EBI-25615276	0.35
Q09302	Uncharacterized protein F07F6.1	EBI-25615276	0.35
Q22935	Uncharacterized protein	EBI-25615276	0.35
Q86B36	Phenylalanine--tRNA ligase (EC 6.1.1.20)	EBI-25615276	0.35
Q9N384	Galectin	EBI-25615276	0.35
O44674	7TM_GPCR_Srx domain-containing protein	EBI-25615276	0.35
O17406	AT hook Transcription Factor family	EBI-25615276	0.35
G5EGT7	Eukaryotic translation initiation factor 5B (Translation initiation factor IF-2)	EBI-25615276	0.35
H2KYR1	HABP4_PAI-RBP1 domain-containing protein	EBI-25615276	0.35
Q23059	Serpentine Receptor, class M	EBI-25615276	0.35
Q86NI2	A_deaminase domain-containing protein	EBI-25615276	0.35
O44454	Serpentine Receptor, class Z	EBI-25615276	0.35
Q9GZH5	26S proteasome non-ATPase regulatory subunit 2	EBI-25615276	0.35
D3YT47	Transposase	EBI-25615276	0.35
C6KRN1	Suppressor of aph-1	EBI-25615276	0.35
Q9XW62	RanBD1 domain-containing protein	EBI-25615276	0.35
A6ZJ59	SH3 domain-containing protein	EBI-25615276	0.35
O02224	C. Elegans Homeobox	EBI-25615276	0.35
G5EBK8	GTP binding protein (R-RAS related) (R-ras1 homolog)	EBI-25615276	0.35
Q1ZXT0	Glutaredoxin domain-containing protein	EBI-25615276	0.35
G5EF26	Alpha-2-MRAP_C domain-containing protein (Putative low density lipoprotein receptor associated protein (37.4 kD))	EBI-25615276	0.35
Q8STE5	Cell death abnormality protein 12	EBI-25615276	0.35
Q21253	Gelsolin-like protein 1	EBI-25615276	0.35
Q19749	Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (EC 2.3.1.12) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex) (Pyruvate dehydrogenase complex component E2) (PDC-E2) (PDCE2)	EBI-25615276	0.35
O44451	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial (PDHE1-B) (EC 1.2.4.1)	EBI-25615276	0.35
O17953	Dihydrolipoyl dehydrogenase, mitochondrial (EC 1.8.1.4) (Dihydrolipoamide dehydrogenase)	EBI-25615276	0.35
O17732	Pyruvate carboxylase 1 (EC 6.4.1.1) (Pyruvic carboxylase 1) (PCB 1)	EBI-25615276	0.35
G5EFK8	EGF-like domain-containing protein	EBI-25615276	0.35
G5ED29	Ataxin-2 homolog	EBI-25615276	0.35
Q20624	Molybdenum cofactor biosynthesis protein moc-5 [Includes: GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A); Cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) (Molybdenum cofactor biosynthesis protein C)]	EBI-25615276	0.35
Q9XVR8	Putative H/ACA ribonucleoprotein complex subunit 3 (Nucleolar protein 10) (Nucleolus associated protein homolog 3)	EBI-25615276	0.35
Q69Z12	Myosin Light Chain	EBI-25615276	0.35
Q21088	GEX Interacting protein	EBI-25615276	0.35
Q21201	Myosin Light Chain	EBI-25615276	0.35
Q9U332	60S ribosomal protein L31	EBI-25615276	0.35
P90747	Probable manganese-transporting ATPase catp-8 (EC 7.2.2.-) (Cation transporting ATPase 8)	EBI-25615276	0.35
O17679	Histone-lysine N-methyltransferase set-6 (EC 2.1.1.-) (EC 2.1.1.366)	EBI-25615276	0.35
O01757	RNA cytidine acetyltransferase (EC 2.3.1.-) (18S rRNA cytosine acetyltransferase)	EBI-25615276	0.35
Q10129	Probable 28S ribosomal protein S16, mitochondrial (MRP-S16) (S16mt)	EBI-25615276	0.35
Q9U1W1	Protein tfg-1	EBI-25615276	0.35
G5EF87	SANT domain-containing protein (SWI3-like protein)	EBI-25615276	0.35
Q21018	Conserved regulator of innate immunity protein 3	EBI-25615276	0.35
G5EBX5	Poly(A) polymerase (EC 2.7.7.19)	EBI-25615276	0.35
O44952	Lon protease homolog, mitochondrial (EC 3.4.21.53)	EBI-25615276	0.35
O62415	Lysozyme-like protein 1	EBI-25615276	0.35
Q22832	MFS domain-containing protein	EBI-25615276	0.35
O45784	Transcription initiation factor TFIID subunit 9 (TBP-associated transcription factor family member taf-9)	EBI-25615276	0.35
G5ECZ0	Heavy chain, Unconventional Myosin (Myosin IA)	EBI-25615276	0.35
Q22078	Nuclear pore complex protein Nup85	EBI-25615276	0.35
Q21831	SNF chromatin remodeling Complex component	EBI-25615276	0.35
O62270	Uncharacterized protein	EBI-25615276	0.35
Q21021	Nuclear Pore complex Protein	EBI-25615276	0.35
O62228	F-box domain-containing protein	EBI-25615276	0.35
Q9XV68	Fatty Acid CoA Synthetase family	EBI-25615276	0.35
O45378	ShKT domain-containing protein	EBI-25615276	0.35
G5EF53	SWI/SNF nucleosome remodeling complex component (SWI2/SNF2-like protein)	EBI-25615276	0.35
G5EBX3	Cyclin L homolog cyl-1	EBI-25615276	0.35
O45279	2-oxoacid_dh domain-containing protein	EBI-25615276	0.35
Q17817	PBPe domain-containing protein	EBI-25615276	0.35
Q17763	ATP synthase subunit d, mitochondrial	EBI-25615276	0.35
Q17629	TransThyretin-Related family domain	EBI-25615276	0.35
Q10941	Putative UDP-glucuronosyltransferase ugt-46 (UDPGT 46) (EC 2.4.1.17)	EBI-25615276	0.35
Q09449	Uncharacterized ATP-dependent helicase C05C10.2 (EC 3.6.4.-)	EBI-25615276	0.35
P52899	Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial (PDHE1-A) (EC 1.2.4.1)	EBI-25615276	0.35
Q10002	Apurinic-apyrimidinic endonuclease (AP endonuclease) (EC 3.1.21.-)	EBI-25615276	0.35
Q09665	Troponin C, isoform 2	EBI-25615276	0.35
P34328	Heat shock protein Hsp-12.2	EBI-25615276	0.35
P34339	Eukaryotic translation initiation factor 3 subunit A (eIF3a) (Egg-laying defective protein 45) (Eukaryotic translation initiation factor 3 subunit 10)	EBI-25615276	0.35
P18334	Casein kinase II subunit alpha (CK II subunit alpha) (EC 2.7.11.1)	EBI-25615276	0.35
P16356	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit)	EBI-25616084	0.35
Q6BER6	Mediator of RNA polymerase II transcription subunit 21 (CeSRB7) (Mediator complex subunit 21)	EBI-25616084	0.35
P45966	Mediator of RNA polymerase II transcription subunit 10 (CeMED10) (CeNUT2) (Mediator complex subunit 10)	EBI-25616084	0.35
Q9N337	Mediator of RNA polymerase II transcription subunit 6 (CeMED6) (Mediator complex subunit 6) (c-MED6) (MED-6)	EBI-25616084	0.35
Q95Q17	Mediator of RNA polymerase II transcription subunit 7 (CeMED7) (MED-7) (Lethal protein 49) (Mediator complex subunit 7)	EBI-25616084	0.35
Q93442	Mediator of RNA polymerase II transcription subunit 13 (CeTRAP240) (Lethal protein 19) (Mediator complex subunit 13)	EBI-25616084	0.35
Q9NEL2	Helicase ssl-1 (EC 3.6.4.-) (Swi/snf2-like protein 1)	EBI-25616084	0.35
P91019	ARID domain-containing protein	EBI-25616084	0.35
G5EGU9	Suppressor of zyg-1 protein 20	EBI-25616084	0.35
P34475	Tubulin gamma chain (Gamma-tubulin)	EBI-25616084	0.35
Q09422	Serine/threonine-protein phosphatase Pgam5, mitochondrial (EC 3.1.3.16) (Phosphoglycerate mutase family member 5 homolog)	EBI-25616084	0.35
Q10573	Protein lin-25 (Abnormal cell lineage protein 25)	EBI-25616084	0.35
Q21193	Profilin-3	EBI-25616084	0.35
O45244	Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 (EC 3.6.4.13) (Masculinization of germline protein 4) (Sex determination protein mog-4)	EBI-25616084	0.35
P90916	Probable histone-binding protein lin-53 (Abnormal cell lineage protein 53) (Synthetic multivulva protein p48)	EBI-25616084	0.35
Q9N5A1	Mediator of RNA polymerase II transcription subunit 20 (Mediator complex subunit 20)	EBI-25616084	0.35
O02042	Mediator of RNA polymerase II transcription subunit 1.2 (Mediator complex subunit 1.2)	EBI-25616084	0.35
Q965S8	Eukaryotic translation initiation factor 3 subunit I (eIF3i)	EBI-25616084	0.35
Q09242	BCL7-like protein	EBI-25616084	0.35
P30632	ATPase asna-1 (EC 3.6.-.-) (Arsenical pump-driving ATPase) (Arsenite-stimulated ATPase)	EBI-25616084	0.35
Q9N350	SHSP domain-containing protein	EBI-25616084	0.35
Q17795	WASP (Actin cytoskeleton modulator) homolog	EBI-25616084	0.35
Q8WQ97	Transcription initiation factor TFIID subunit 8	EBI-25616084	0.35
Q9GZI6	TAF domain-containing protein	EBI-25616084	0.35
Q20563	TAFII28 domain-containing protein	EBI-25616084	0.35
Q21172	Transcription initiation factor TFIID subunit 10	EBI-25616084	0.35
P91453	Uncharacterized protein	EBI-25616084	0.35
A9D0C6	WD_REPEATS_REGION domain-containing protein	EBI-25616084	0.35
Q8MXR6	Homologous to Drosophila SQD (Squid) protein	EBI-25616084	0.35
Q23026	Tyrosine-protein phosphatase domain-containing protein	EBI-25616084	0.35
O01505	Prion-like-(Q/N-rich)-domain-bearing protein	EBI-25616084	0.35
A6ZJ71	Abnormal cell migration protein 38	EBI-25616084	0.35
D5SGZ9	Mediator complex subunit 9	EBI-25616084	0.35
Q5H9M9	SHSP domain-containing protein	EBI-25616084	0.35
H2KZN0	HnRNP F homolog	EBI-25616084	0.35
Q9N5S7	ThioredoXin Domain Containing protein homolog	EBI-25616084	0.35
Q93315	Cytochrome b5 heme-binding domain-containing protein	EBI-25616084	0.35
Q20937	CCR4-NOT transcription complex subunit let-711 (CCR4-associated factor let-711) (Lethal protein 711) (Negative regulator of transcription subunit 1 homolog) (NOT1)	EBI-25616084	0.35
P10771	Histone 24 (Histone H1.1)	EBI-25616084	0.35
O61793	MIR domain-containing protein	EBI-25616084	0.35
Q23523	Mediator of RNA polymerase II transcription subunit 4 (Mediator complex subunit 4)	EBI-25616084	0.35
Q23679	Mediator of RNA polymerase II transcription subunit 22 (Mediator complex subunit 22)	EBI-25616084	0.35
Q9N4F2	Mediator of RNA polymerase II transcription subunit 19 (Mediator complex subunit 19)	EBI-25616084	0.35
Q966M5	Mediator of RNA polymerase II transcription subunit 18 (Mediator complex subunit 18)	EBI-25616084	0.35
Q10661	Dosage compensation protein dpy-30 (Protein dumpy-30)	EBI-25616084	0.35
P90866	Cyclin-dependent kinase 8 (EC 2.7.11.22) (EC 2.7.11.23) (Cell division protein kinase 8) (Mediator complex subunit cdk-8) (Mediator of RNA polymerase II transcription subunit cdk-8)	EBI-25616084	0.35
Q9BKQ7	Uncharacterized protein	EBI-25616084	0.35
Q20010	Spindle assembly abnormal protein 5	EBI-25616084	0.35
Q8I4M5	Germline survival defective-1	EBI-25616084	0.35
Q9NA98	Actin-Related Proteins	EBI-25616084	0.35
Q17740	ALG-1 INteracting protein	EBI-25616084	0.35
Q9XZI6	Phosphatidylinositol-binding clathrin assembly protein unc-11 (AP180-like adaptor protein) (Uncoordinated protein 11)	EBI-25616084	0.35
Q17963	WD repeat-containing protein wdr-5.1	EBI-25616084	0.35
Q9BI74	Mediator of RNA polymerase II transcription subunit 11 (Mediator complex subunit 11)	EBI-25616084	0.35
Q03570	Mediator of RNA polymerase II transcription subunit 14 (Mediator complex subunit 14) (Mediator complex subunit rgr-1)	EBI-25616084	0.35
Q94046	PIS (Pax-2, IA-1/6, Smad-2 interacting protein) homolog	EBI-25616084	0.35
Q2A949	PHD-type domain-containing protein	EBI-25616084	0.35
G5EEY5	HMG box domain-containing protein	EBI-25616084	0.35
H9G301	Coiled-coil domain-containing protein mdt-28	EBI-25616084	0.35
Q9N363	mRNA-decapping enzyme 1	EBI-25616084	0.35
O61707	Transcription initiation factor TFIID subunit 4 (TBP-associated transcription factor family member taf-4)	EBI-25616084	0.35
A5JYT2	Bromo domain-containing protein	EBI-25616084	0.35
Q9XUS2	Mediator of RNA polymerase II transcription subunit 29 (Mediator complex subunit 29)	EBI-25616084	0.35
Q22944	Methyltransferase-like protein 13	EBI-25616084	0.35
Q9U1W2	Mediator of RNA polymerase II transcription subunit 8 (Mediator complex subunit 8)	EBI-25616084	0.35
G5EGI1	Histone-lysine N-methyltransferase	EBI-25616084	0.35
P34428	Glutamine/asparagine-rich protein mdt-30	EBI-25616084	0.35
Q20497	Mediator of RNA polymerase II transcription subunit 12 (CeTRAP230) (Mediator complex subunit 12) (Protein dumpy-22)	EBI-25616084	0.35
Q9NAL4	Mediator of RNA polymerase II transcription subunit 17 (Mediator complex subunit 17)	EBI-25616084	0.35
Q9XW73	TAF4 domain-containing protein	EBI-25616084	0.35
Q2XN10	Protein kinase domain-containing protein	EBI-25616084	0.35
Q9N4G4	Mediator of RNA polymerase II transcription subunit 1.1 (Mediator complex subunit 1.1) (Suppressor of pal-1 protein 3)	EBI-25616084	0.35
Q09477	Zinc finger protein dpff-1	EBI-25616084	0.35

Cross-References

Database	Links
UNIPROT	O02101
Pfam	PF02201

SWI/SNF chromatin-remodeling accessory subunit 2 (Caenorhabditis elegans)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Interactions with other proteins (171 interactors)

Cross-References

Database

Links

Description

Description