NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Apoptosis regulator Bcl-2 - Bos taurus - NucEnvDB

Apoptosis regulator Bcl-2 (Bos taurus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Apoptosis regulator Bcl-2
Accession Code	O02718
Gene	BCL2
Organism	Bos taurus \| Cattle (Taxonomy: 9913)
Part of Reference Proteome?	Yes
Sequence (Length: 229)
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARERFATVVEELFRD GVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK

Subcellular Location

Description
Mitochondrion outer membrane {By SimilarityUniProtKB:P10415}; Single-pass membrane protein {Sequence Analysis}. Nucleus membrane {By SimilarityUniProtKB:P10415}; Single- pass membrane protein {Sequence Analysis}. Endoplasmic reticulum membrane {By SimilarityUniProtKB:P10415}; Single-pass membrane protein {Sequence Analysis}. Cytoplasm {ECO:0000250\|UniProtKB:P10417}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Endoplasmic Reticulum Membrane (GO:0005789) Membrane (GO:0016020) Mitochondrial Outer Membrane (GO:0005741) Mitochondrion (GO:0005739) Nuclear Membrane (GO:0031965)

Biology & Function

Description
Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function. May attenuate inflammation by impairing NLRP1- inflammasome activation, hence CASP1 activation and IL1B release. {By SimilarityUniProtKB:P10415}.
Assigned Ontology terms

Biological Process	Extrinsic Apoptotic Signaling Pathway In Absence Of Ligand (GO:0097192) Intrinsic Apoptotic Signaling Pathway In Response To DNA Damage (GO:0008630) Negative Regulation Of Apoptotic Process (GO:0043066) Negative Regulation Of Autophagy (GO:0010507) Negative Regulation Of Cellular PH Reduction (GO:0032848) Negative Regulation Of Intrinsic Apoptotic Signaling Pathway (GO:2001243) Regulation Of Mitochondrial Membrane Permeability (GO:0046902) Regulation Of Mitochondrial Membrane Potential (GO:0051881) Release Of Cytochrome C From Mitochondria (GO:0001836)
Molecular Function	Protein Heterodimerization Activity (GO:0046982) Protein Homodimerization Activity (GO:0042803)

Cross-References

Database	Links
UNIPROT	O02718
Pfam	PF00452 PF02180
PROSITE	PS50062 PS01080 PS01258 PS01259 PS01260 PS50063

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK