Histone-lysine N-methyltransferase SUV39H1 - Homo sapiens

Histone-lysine N-methyltransferase SUV39H1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Histone-lysine N-methyltransferase SUV39H1
Accession Code	O43463
Gene	SUV39H1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 412)
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYYLVKWRGYPDSESTWEPRQNL KCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQKAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAF VYINEYRVGEGITLNQVAVGCECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFDLDYVEDVYTVDAAYYGNISH FVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIEC KCGTESCRKYLF

Structure Viewer (PDB: 3MTS)

Subcellular Location

Description
Nucleus. Nucleus lamina. Nucleus, nucleoplasm. Chromosome, centromere. Note=Associates with centromeric constitutive heterochromatin.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Lamina	SL-0180	The nuclear lamina is a meshwork of intermediate filament proteins called lamins and lamin-binding proteins that are embedded in the inner nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Chromatin Silencing Complex (GO:0005677) Chromosome, Centromeric Region (GO:0000775) Condensed Nuclear Chromosome (GO:0000794) ENoSc Complex (GO:0061773) Heterochromatin (GO:0000792) Nuclear Lamina (GO:0005652) Nucleolus (GO:0005730) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) RDNA Heterochromatin (GO:0033553)

Biology & Function

Description
Histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3 using monomethylated H3 'Lys-9' as substrate. Also weakly methylates histone H1 (in vitro). H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Mainly functions in heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin at pericentric and telomere regions. H3 'Lys-9' trimethylation is also required to direct DNA methylation at pericentric repeats. SUV39H1 is targeted to histone H3 via its interaction with RB1 and is involved in many processes, such as repression of MYOD1-stimulated differentiation, regulation of the control switch for exiting the cell cycle and entering differentiation, repression by the PML-RARA fusion protein, BMP-induced repression, repression of switch recombination to IgA and regulation of telomere length. Component of the eNoSC (energy-dependent nucleolar silencing) complex, a complex that mediates silencing of rDNA in response to intracellular energy status and acts by recruiting histone-modifying enzymes. The eNoSC complex is able to sense the energy status of cell: upon glucose starvation, elevation of NAD(+)/NADP(+) ratio activates SIRT1, leading to histone H3 deacetylation followed by dimethylation of H3 at 'Lys-9' (H3K9me2) by SUV39H1 and the formation of silent chromatin in the rDNA locus. Recruited by the large PER complex to the E-box elements of the circadian target genes such as PER2 itself or PER1, contributes to the conversion of local chromatin to a heterochromatin-like repressive state through H3 'Lys-9' trimethylation. {Experimental EvidencePubMed:14765126, Experimental EvidencePubMed:16449642, Experimental EvidencePubMed:16818776, Experimental EvidencePubMed:16858404, Experimental EvidencePubMed:18004385, Experimental EvidencePubMed:18485871}.
Assigned Ontology terms

Biological Process	Cell Cycle (GO:0007049) Cell Differentiation (GO:0030154) Cellular Response To DNA Damage Stimulus (GO:0006974) Cellular Response To Glucose Starvation (GO:0042149) Cellular Response To Hypoxia (GO:0071456) Chromatin Organization (GO:0006325) Energy Homeostasis (GO:0097009) Histone H3-K9 Dimethylation (GO:0036123) Histone H3-K9 Trimethylation (GO:0036124) Histone Lysine Methylation (GO:0034968) Negative Regulation Of Cell Cycle (GO:0045786) Negative Regulation Of Circadian Rhythm (GO:0042754) Negative Regulation Of DNA-Templated Transcription (GO:0045892) Negative Regulation Of Transcription By RNA Polymerase II (GO:0000122) Positive Regulation Of Histone Deacetylation (GO:0031065) Positive Regulation Of Histone Methylation (GO:0031062) RDNA Heterochromatin Formation (GO:0000183) Regulation Of Transcription By Glucose (GO:0046015) Rhythmic Process (GO:0048511) RRNA Processing (GO:0006364)
Molecular Function	Chromatin Binding (GO:0003682) Histone Methyltransferase Activity (GO:0042054) Histone H3K9 Methyltransferase Activity (GO:0046974) Histone Lysine N-Methyltransferase Activity (GO:0018024) Protein N-Terminus Binding (GO:0047485) S-Adenosylmethionine-Dependent Methyltransferase Activity (GO:0008757) Transcription Cis-Regulatory Region Binding (GO:0000976) Zinc Ion Binding (GO:0008270)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q8IZQ1	WD repeat and FYVE domain-containing protein 3	EBI-8487862	0.37
Q9H0H0	Integrator complex subunit 2	EBI-8471498	0.37
Q9Y2M5	Kelch-like protein 20	EBI-8472700	0.37
Q9UDY8	Mucosa-associated lymphoid tissue lymphoma translocation protein 1	EBI-8474830	0.37
Interactions with other proteins (156 interactors)

Partner (UniProt)		IntAct	Confidence score
P68432	Histone H3.1	EBI-350122	0.44
P68431	Histone H3.1 (Histone H3/a) (Histone H3/b) (Histone H3/c) (Histone H3/d) (Histone H3/f) (Histone H3/h) (Histone H3/i) (Histone H3/j) (Histone H3/k) (Histone H3/l)	EBI-360204	0.40
P45973	Chromobox protein homolog 5 (Antigen p25) (Heterochromatin protein 1 homolog alpha) (HP1 alpha)	EBI-760225	0.95
Q15156	PML-RAR protein	EBI-869185	0.52
P29590	Protein PML (E3 SUMO-protein ligase PML) (EC 2.3.2.-) (Promyelocytic leukemia protein) (RING finger protein 71) (RING-type E3 SUMO transferase PML) (Tripartite motif-containing protein 19) (TRIM19)	EBI-870893	0.40
Q9UIS9	Methyl-CpG-binding domain protein 1 (CXXC-type zinc finger protein 3) (Methyl-CpG-binding protein MBD1) (Protein containing methyl-CpG-binding domain 1)	EBI-994581	0.56
Q13547	Histone deacetylase 1 (HD1) (EC 3.5.1.98) (Protein deacetylase HDAC1) (EC 3.5.1.-) (Protein decrotonylase HDAC1) (EC 3.5.1.-)	EBI-994733	0.52
Q92769	Histone deacetylase 2 (HD2) (EC 3.5.1.98) (Protein deacylase HDAC2) (EC 3.5.1.-)	EBI-994747	0.52
Q9C0K0	B-cell lymphoma/leukemia 11B (BCL-11B) (B-cell CLL/lymphoma 11B) (COUP-TF-interacting protein 2) (Radiation-induced tumor suppressor gene 1 protein) (hRit1)	EBI-7212308	0.56
O43159	Ribosomal RNA-processing protein 8 (EC 2.1.1.-) (Cerebral protein 1) (Nucleomethylin)	EBI-2008823	0.52
Q96ED9	Protein Hook homolog 2 (h-hook2) (hHK2)	EBI-8647977	0.67
O00257	E3 SUMO-protein ligase CBX4 (EC 2.3.2.-) (Chromobox protein homolog 4) (Polycomb 2 homolog) (Pc2) (hPc2)	EBI-5277008	0.44
O95260	Arginyl-tRNA--protein transferase 1 (Arginyltransferase 1) (R-transferase 1) (EC 2.3.2.8) (Arginine-tRNA--protein transferase 1)	EBI-8464506	0.51
P15313	V-type proton ATPase subunit B, kidney isoform (V-ATPase subunit B 1) (Endomembrane proton pump 58 kDa subunit) (Vacuolar proton pump subunit B 1)	EBI-8464546	0.37
P18847	Cyclic AMP-dependent transcription factor ATF-3 (cAMP-dependent transcription factor ATF-3) (Activating transcription factor 3)	EBI-8464526	0.37
Q8TBE0	Bromo adjacent homology domain-containing 1 protein (BAH domain-containing protein 1)	EBI-8464603	0.37
Q9NWQ4	G patch domain-containing protein 2-like	EBI-8465349	0.51
Q86X59	Putative uncharacterized protein LINC02875	EBI-8465546	0.37
Q5T0J7	Testis-expressed protein 35	EBI-8465745	0.37
Q53FE4	Uncharacterized protein C4orf17	EBI-8465880	0.37
Q6P047	Uncharacterized protein C8orf74	EBI-8466103	0.51
Q96H12	Myb/SANT-like DNA-binding domain-containing protein 3	EBI-8466221	0.37
A5D8V7	Outer dynein arm-docking complex subunit 3 (Coiled-coil domain-containing protein 151)	EBI-8466476	0.51
Q494V2	Cilia- and flagella-associated protein 100 (Coiled-coil domain-containing protein 37)	EBI-8466606	0.37
Q9UJX2	Cell division cycle protein 23 homolog (Anaphase-promoting complex subunit 8) (APC8) (Cyclosome subunit 8)	EBI-8466789	0.37
Q9BXL8	Cell division cycle-associated protein 4 (Hematopoietic progenitor protein)	EBI-8466866	0.51
Q96GN5	Cell division cycle-associated 7-like protein (Protein JPO2) (Transcription factor RAM2)	EBI-8467032	0.37
P49761	Dual specificity protein kinase CLK3 (EC 2.7.12.1) (CDC-like kinase 3)	EBI-8467270	0.51
Q96SW2	Protein cereblon	EBI-8467328	0.37
Q6UXH1	Protein disulfide isomerase CRELD2 (EC 5.3.4.1) (Cysteine-rich with EGF-like domain protein 2)	EBI-8467387	0.37
Q8NFT6	Protein DBF4 homolog B (Activator of S phase kinase-like protein 1) (ASK-like protein 1) (Chiffon homolog B) (Dbf4-related factor 1)	EBI-8467523	0.37
P60002	Transcription elongation factor 1 homolog	EBI-8467848	0.37
Q15910	Histone-lysine N-methyltransferase EZH2 (EC 2.1.1.356) (ENX-1) (Enhancer of zeste homolog 2) (Lysine N-methyltransferase 6)	EBI-8468009	0.51
Q6ZNL6	FYVE, RhoGEF and PH domain-containing protein 5 (Zinc finger FYVE domain-containing protein 23)	EBI-8468327	0.51
Q6PJQ5	Forkhead box protein R2 (Forkhead box protein N6)	EBI-8468537	0.37
Q96NE9	FERM domain-containing protein 6 (Willin)	EBI-8468582	0.37
P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	EBI-8468619	0.37
P06241	Tyrosine-protein kinase Fyn (EC 2.7.10.2) (Proto-oncogene Syn) (Proto-oncogene c-Fyn) (Src-like kinase) (SLK) (p59-Fyn)	EBI-8468767	0.37
Q6P1K8	General transcription factor IIH subunit 2-like protein (General transcription factor IIH polypeptide 2-like protein)	EBI-8469749	0.37
Q9BX10	GTP-binding protein 2	EBI-8469814	0.51
Q6NXT2	Histone H3.3C (Histone H3.5)	EBI-8469928	0.37
P49639	Homeobox protein Hox-A1 (Homeobox protein Hox-1F)	EBI-8470602	0.51
P09017	Homeobox protein Hox-C4 (Homeobox protein CP19) (Homeobox protein Hox-3E)	EBI-8470785	0.51
P41134	DNA-binding protein inhibitor ID-1 (Class B basic helix-loop-helix protein 24) (bHLHb24) (Inhibitor of DNA binding 1) (Inhibitor of differentiation 1)	EBI-8470899	0.37
Q02363	DNA-binding protein inhibitor ID-2 (Class B basic helix-loop-helix protein 26) (bHLHb26) (Inhibitor of DNA binding 2) (Inhibitor of differentiation 2)	EBI-8470956	0.37
P22692	Insulin-like growth factor-binding protein 4 (IBP-4) (IGF-binding protein 4) (IGFBP-4)	EBI-8471165	0.37
Q14005	Pro-interleukin-16 [Cleaved into: Interleukin-16 (IL-16) (Lymphocyte chemoattractant factor) (LCF)]	EBI-8471351	0.37
Q9UNL4	Inhibitor of growth protein 4 (p29ING4)	EBI-8471427	0.37
Q9UIH9	Krueppel-like factor 15 (Kidney-enriched krueppel-like factor)	EBI-8472230	0.37
Q8TBB5	Kelch domain-containing protein 4	EBI-8472509	0.51
Q9BYZ2	L-lactate dehydrogenase A-like 6B (EC 1.1.1.27)	EBI-8473716	0.37
Q96PV6	Leukocyte receptor cluster member 8	EBI-8473810	0.37
Q68G74	LIM/homeobox protein Lhx8 (LIM homeobox protein 8)	EBI-8474100	0.37
Q8TBB1	E3 ubiquitin-protein ligase LNX (EC 2.3.2.27) (Ligand of Numb-protein X 1) (Numb-binding protein 1) (PDZ domain-containing RING finger protein 2) (RING-type E3 ubiquitin transferase LNX)	EBI-8474341	0.37
Q96JB6	Lysyl oxidase homolog 4 (EC 1.4.3.-) (Lysyl oxidase-like protein 4) (Lysyl oxidase-related protein C)	EBI-8474426	0.37
O95243	Methyl-CpG-binding domain protein 4 (EC 3.2.2.-) (Methyl-CpG-binding endonuclease 1) (Methyl-CpG-binding protein MBD4) (Mismatch-specific DNA N-glycosylase)	EBI-8474998	0.37
Q96EZ8	Microspherule protein 1 (58 kDa microspherule protein) (Cell cycle-regulated factor p78) (INO80 complex subunit J) (MCRS2)	EBI-8475092	0.37
Q9Y483	Metal-response element-binding transcription factor 2 (Metal regulatory transcription factor 2) (Metal-response element DNA-binding protein M96) (Polycomb-like protein 2) (hPCl2)	EBI-8476026	0.37
Q9Y2Z2	Protein MTO1 homolog, mitochondrial	EBI-8476214	0.37
P55055	Oxysterols receptor LXR-beta (Liver X receptor beta) (Nuclear receptor NER) (Nuclear receptor subfamily 1 group H member 2) (Ubiquitously-expressed nuclear receptor)	EBI-8477342	0.37
Q13133	Oxysterols receptor LXR-alpha (Liver X receptor alpha) (Nuclear receptor subfamily 1 group H member 3)	EBI-8477418	0.51
Q9H6K4	Optic atrophy 3 protein	EBI-8477926	0.37
Q5T6S3	PHD finger protein 19 (Polycomb-like protein 3) (hPCL3)	EBI-8478603	0.51
Q96T60	Bifunctional polynucleotide phosphatase/kinase (DNA 5'-kinase/3'-phosphatase) (Polynucleotide kinase-3'-phosphatase) [Includes: Polynucleotide 3'-phosphatase (EC 3.1.3.32) (2'(3')-polynucleotidase); Polynucleotide 5'-hydroxyl-kinase (EC 2.7.1.78)]	EBI-8478792	0.37
P49643	DNA primase large subunit (DNA primase 58 kDa subunit) (p58)	EBI-8479094	0.37
P62191	26S proteasome regulatory subunit 4 (P26s4) (26S proteasome AAA-ATPase subunit RPT2) (Proteasome 26S subunit ATPase 1)	EBI-8479522	0.51
Q9NS23	Ras association domain-containing protein 1	EBI-8480267	0.51
P50749	Ras association domain-containing protein 2	EBI-8480360	0.51
Q6UXX9	R-spondin-2 (Roof plate-specific spondin-2) (hRspo2)	EBI-8481068	0.37
Q8IYM2	Ribonuclease SLFN12 (EC 3.1.-.-) (Schlafen family member 12)	EBI-8481728	0.37
Q86W54	Spermatogenesis-associated protein 24 (Testis protein T6441 homolog)	EBI-8483275	0.37
Q7Z699	Sprouty-related, EVH1 domain-containing protein 1 (Spred-1) (hSpred1)	EBI-8483411	0.37
Q96BD6	SPRY domain-containing SOCS box protein 1 (SSB-1)	EBI-8483512	0.51
O43295	SLIT-ROBO Rho GTPase-activating protein 3 (srGAP3) (Mental disorder-associated GAP) (Rho GTPase-activating protein 14) (WAVE-associated Rac GTPase-activating protein) (WRP)	EBI-8483786	0.37
O75558	Syntaxin-11	EBI-8484895	0.37
Q8N4C7	Syntaxin-19	EBI-8485007	0.51
O60341	Lysine-specific histone demethylase 1A (EC 1.14.99.66) (BRAF35-HDAC complex protein BHC110) (Flavin-containing amine oxidase domain-containing protein 2) ([histone H3]-dimethyl-L-lysine(4) FAD-dependent demethylase 1A)	EBI-8485081	0.37
Q96LA8	Protein arginine N-methyltransferase 6 (EC 2.1.1.319) (Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6) (Histone-arginine N-methyltransferase PRMT6)	EBI-8485135	0.37
P17152	Transmembrane protein 11, mitochondrial (Protein PM1) (Protein PMI)	EBI-8485829	0.37
Q13829	BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2 (hBACURD2) (BTB/POZ domain-containing protein TNFAIP1) (Protein B12) (Tumor necrosis factor, alpha-induced protein 1, endothelial)	EBI-8485866	0.37
Q01081	Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit)	EBI-8487076	0.51
Q5TAQ9	DDB1- and CUL4-associated factor 8 (WD repeat-containing protein 42A)	EBI-8488086	0.51
O95785	Protein Wiz (Widely-interspaced zinc finger-containing protein) (Zinc finger protein 803)	EBI-8488561	0.37
O43167	Zinc finger and BTB domain-containing protein 24 (Zinc finger protein 450)	EBI-8488636	0.37
Q9NP64	Zinc finger CCHC domain-containing protein 17 (Nucleolar protein of 40 kDa) (pNO40) (Pnn-interacting nucleolar protein) (Putative S1 RNA-binding domain protein) (PS1D protein)	EBI-8488764	0.37
Q9Y2L8	Zinc finger protein with KRAB and SCAN domains 5 (Zinc finger protein 95 homolog) (Zfp-95)	EBI-8488958	0.51
P49910	Zinc finger protein 165 (Cancer/testis antigen 53) (CT53) (LD65) (Zinc finger and SCAN domain-containing protein 7)	EBI-8489049	0.37
O15535	Zinc finger and SCAN domain-containing protein 9 (Cell proliferation-inducing gene 12 protein) (PRD51) (Zinc finger protein 193)	EBI-8489086	0.37
Q9C0F3	Zinc finger protein 436	EBI-8489696	0.51
Q9Y4E5	E3 SUMO-protein ligase ZNF451 (EC 2.3.2.-) (Coactivator for steroid receptors) (E3 SUMO-protein transferase ZNF451) (Zinc finger protein 451)	EBI-8490124	0.37
Q68EA5	Zinc finger protein 57 (Zinc finger protein 424)	EBI-8490810	0.37
Q9BS31	Zinc finger protein 649	EBI-8491151	0.51
Q9BS34	Zinc finger protein 670	EBI-8491255	0.51
Q3KNS6	Zinc finger protein 829	EBI-8491346	0.37
Q13185	Chromobox protein homolog 3 (HECH) (Heterochromatin protein 1 homolog gamma) (HP1 gamma) (Modifier 2 protein)	EBI-8831531	0.74
P17987	T-complex protein 1 subunit alpha (TCP-1-alpha) (CCT-alpha)	EBI-8836034	0.35
Q99832	T-complex protein 1 subunit eta (TCP-1-eta) (CCT-eta) (HIV-1 Nef-interacting protein) [Cleaved into: T-complex protein 1 subunit eta, N-terminally processed]	EBI-8836034	0.35
P48643	T-complex protein 1 subunit epsilon (TCP-1-epsilon) (CCT-epsilon)	EBI-8836034	0.35
P78371	T-complex protein 1 subunit beta (TCP-1-beta) (CCT-beta)	EBI-8836034	0.35
P50991	T-complex protein 1 subunit delta (TCP-1-delta) (CCT-delta) (Stimulator of TAR RNA-binding)	EBI-8836034	0.35
P40227	T-complex protein 1 subunit zeta (TCP-1-zeta) (Acute morphine dependence-related protein 2) (CCT-zeta-1) (HTR3) (Tcp20)	EBI-8836034	0.35
P83916	Chromobox protein homolog 1 (HP1Hsbeta) (Heterochromatin protein 1 homolog beta) (HP1 beta) (Heterochromatin protein p25) (M31) (Modifier 1 protein) (p25beta)	EBI-8836034	0.67
P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	EBI-8836034	0.35
P49368	T-complex protein 1 subunit gamma (TCP-1-gamma) (CCT-gamma) (hTRiC5)	EBI-8836034	0.35
O75556	Mammaglobin-B (Lacryglobin) (Lipophilin-C) (Mammaglobin-2) (Secretoglobin family 2A member 1)	EBI-8836034	0.35
Q8IWI9	MAX gene-associated protein (MAX dimerization protein 5)	EBI-8836034	0.35
Q14839	Chromodomain-helicase-DNA-binding protein 4 (CHD-4) (EC 3.6.4.12) (ATP-dependent helicase CHD4) (Mi-2 autoantigen 218 kDa protein) (Mi2-beta)	EBI-8836034	0.35
P50990	T-complex protein 1 subunit theta (TCP-1-theta) (CCT-theta) (Chaperonin containing T-complex polypeptide 1 subunit 8) (Renal carcinoma antigen NY-REN-15)	EBI-8836034	0.35
O60281	Zinc finger protein 292	EBI-8836034	0.35
Q63HR2	Tensin-2 (EC 3.1.3.48) (C1 domain-containing phosphatase and tensin homolog) (C1-TEN) (Tensin-like C1 domain-containing phosphatase)	EBI-10697145	0.37
Q8TB24	Ras and Rab interactor 3 (Ras interaction/interference protein 3)	EBI-10700383	0.37
P60409	Keratin-associated protein 10-7 (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7)	EBI-10183935	0.72
Q8NHQ1	Centrosomal protein of 70 kDa (Cep70) (p10-binding protein)	EBI-10183945	0.56
Q9BRK4	Leucine zipper putative tumor suppressor 2 (hLZTS2) (Protein LAPSER1)	EBI-10183965	0.72
V9HWG0	Chromobox homolog 5 (HP1 alpha homolog, Drosophila), isoform CRA_b (Epididymis luminal protein 25)	EBI-10183975	0.56
P52732	Kinesin-like protein KIF11 (Kinesin-like protein 1) (Kinesin-like spindle protein HKSP) (Kinesin-related motor protein Eg5) (Thyroid receptor-interacting protein 5) (TR-interacting protein 5) (TRIP-5)	EBI-11007621	0.35
P83917	Chromobox protein homolog 1 (Heterochromatin protein 1 homolog beta) (HP1 beta) (Heterochromatin protein p25) (M31) (Modifier 1 protein)	EBI-11012671	0.35
P24588	A-kinase anchor protein 5 (AKAP-5) (A-kinase anchor protein 79 kDa) (AKAP 79) (H21) (cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein)	EBI-11022813	0.35
Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	EBI-11088574	0.35
P26447	Protein S100-A4 (Calvasculin) (Metastasin) (Placental calcium-binding protein) (Protein Mts1) (S100 calcium-binding protein A4)	EBI-11158347	0.35
Q92997	Segment polarity protein dishevelled homolog DVL-3 (Dishevelled-3) (DSH homolog 3)	EBI-24357699	0.56
Q6TGC4	Protein-arginine deiminase type-6 (EC 3.5.3.15) (Peptidyl arginine deiminase-like protein) (Peptidylarginine deiminase VI) (hPADVI) (Protein-arginine deiminase type VI)	EBI-24512010	0.56
P60410	Keratin-associated protein 10-8 (High sulfur keratin-associated protein 10.8) (Keratin-associated protein 10.8) (Keratin-associated protein 18-8) (Keratin-associated protein 18.8)	EBI-24401717	0.56
Q9UGI0	Ubiquitin thioesterase ZRANB1 (EC 3.4.19.12) (TRAF-binding domain-containing protein) (hTrabid) (Zinc finger Ran-binding domain-containing protein 1)	EBI-24411282	0.56
Q8WV44	E3 ubiquitin-protein ligase TRIM41 (EC 2.3.2.27) (RING finger-interacting protein with C kinase) (RINCK) (Tripartite motif-containing protein 41)	EBI-24426170	0.56
Q96I34	Protein phosphatase 1 regulatory subunit 16A (Myosin phosphatase-targeting subunit 3)	EBI-24430731	0.56
Q8N680	Zinc finger and BTB domain-containing protein 2	EBI-24438043	0.56
A6NEM1	Golgin subfamily A member 6-like protein 9	EBI-24471464	0.56
Q8WW24	Tektin-4	EBI-24557231	0.56
Q8TAU3	Zinc finger protein 417	EBI-24563312	0.56
Q7Z4V0	Zinc finger protein 438	EBI-24811250	0.56
Q13371	Phosducin-like protein (PHLP)	EBI-21777725	0.35
Q9UPU5	Ubiquitin carboxyl-terminal hydrolase 24 (EC 3.4.19.12) (Deubiquitinating enzyme 24) (Ubiquitin thioesterase 24) (Ubiquitin-specific-processing protease 24)	EBI-21777725	0.35
Q9NPA3	Mid1-interacting protein 1 (Gastrulation-specific G12-like protein) (Mid1-interacting G12-like protein) (Protein STRAIT11499) (Spot 14-related protein) (S14R) (Spot 14-R)	EBI-21777725	0.35
Q9H582	Zinc finger protein 644 (Zinc finger motif enhancer-binding protein 2) (Zep-2)	EBI-21777725	0.35
Q9H0I2	Enkurin domain-containing protein 1	EBI-21777725	0.35
Q9BTE3	Mini-chromosome maintenance complex-binding protein (MCM-BP) (MCM-binding protein)	EBI-21777725	0.35
Q96KQ7	Histone-lysine N-methyltransferase EHMT2 (EC 2.1.1.-) (EC 2.1.1.367) (Euchromatic histone-lysine N-methyltransferase 2) (HLA-B-associated transcript 8) (Histone H3-K9 methyltransferase 3) (H3-K9-HMTase 3) (Lysine N-methyltransferase 1C) (Protein G9a)	EBI-15916314	0.46
Q93008	Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC 3.4.19.12) (Deubiquitinating enzyme FAF-X) (Fat facets in mammals) (hFAM) (Fat facets protein-related, X-linked) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific protease 9, X chromosome) (Ubiquitin-specific-processing protease FAF-X)	EBI-21777725	0.35
Q70CQ2	Ubiquitin carboxyl-terminal hydrolase 34 (EC 3.4.19.12) (Deubiquitinating enzyme 34) (Ubiquitin thioesterase 34) (Ubiquitin-specific-processing protease 34)	EBI-21777725	0.35
Q6VMQ6	Activating transcription factor 7-interacting protein 1 (ATF-interacting protein) (ATF-IP) (ATF7-interacting protein) (ATFa-associated modulator) (hAM) (MBD1-containing chromatin-associated factor 1) (P621)	EBI-21777725	0.35
Q5TDH0	Protein DDI1 homolog 2 (EC 3.4.23.-)	EBI-21777725	0.35
Q15047	Histone-lysine N-methyltransferase SETDB1 (EC 2.1.1.366) (ERG-associated protein with SET domain) (ESET) (Histone H3-K9 methyltransferase 4) (H3-K9-HMTase 4) (Lysine N-methyltransferase 1E) (SET domain bifurcated 1)	EBI-21777725	0.35
Q15018	BRISC complex subunit Abraxas 2 (Abraxas brother protein 1) (Protein FAM175B)	EBI-21777725	0.35
O60732	Melanoma-associated antigen C1 (Cancer/testis antigen 7.1) (CT7.1) (MAGE-C1 antigen)	EBI-21777725	0.35
Q96EB6	NAD-dependent protein deacetylase sirtuin-1 (hSIRT1) (EC 2.3.1.286) (NAD-dependent protein deacylase sirtuin-1) (EC 2.3.1.-) (Regulatory protein SIR2 homolog 1) (SIR2-like protein 1) (hSIR2) [Cleaved into: SirtT1 75 kDa fragment (75SirT1)]	EBI-15671006	0.54
Q9H9B1	Histone-lysine N-methyltransferase EHMT1 (EC 2.1.1.-) (EC 2.1.1.367) (Euchromatic histone-lysine N-methyltransferase 1) (Eu-HMTase1) (G9a-like protein 1) (GLP) (GLP1) (Histone H3-K9 methyltransferase 5) (H3-K9-HMTase 5) (Lysine N-methyltransferase 1D)	EBI-15916287	0.46
Q14191	Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN (DNA helicase, RecQ-like type 3) (RecQ protein-like 2) (Werner syndrome protein) [Includes: 3'-5' exonuclease (EC 3.1.-.-); ATP-dependent helicase (EC 3.6.4.12)]	EBI-16155310	0.35
Q969R5	Lethal(3)malignant brain tumor-like protein 2 (H-l(3)mbt-like protein 2) (L(3)mbt-like protein 2)	EBI-25485605	0.35
Q9BYN8	28S ribosomal protein S26, mitochondrial (MRP-S26) (S26mt) (28S ribosomal protein S13, mitochondrial) (MRP-S13) (S13mt) (Mitochondrial small ribosomal subunit protein mS26)	EBI-25485605	0.35
Q8N136	Dynein assembly factor with WDR repeat domains 1 (Outer row dynein assembly protein 16 homolog) (WD repeat-containing protein 69)	EBI-25485605	0.35
P50454	Serpin H1 (47 kDa heat shock protein) (Arsenic-transactivated protein 3) (AsTP3) (Cell proliferation-inducing gene 14 protein) (Collagen-binding protein) (Colligin) (Rheumatoid arthritis-related antigen RA-A47)	EBI-25836502	0.56
Q86V38	Atrophin 1	EBI-25846409	0.56
Q92876	Kallikrein-6 (EC 3.4.21.-) (Neurosin) (Protease M) (SP59) (Serine protease 18) (Serine protease 9) (Zyme)	EBI-25887383	0.56
P54725	UV excision repair protein RAD23 homolog A (HR23A) (hHR23A)	EBI-25889399	0.56
P37173	TGF-beta receptor type-2 (TGFR-2) (EC 2.7.11.30) (TGF-beta type II receptor) (Transforming growth factor-beta receptor type II) (TGF-beta receptor type II) (TbetaR-II)	EBI-25892730	0.56

Cross-References

Database	Links
UNIPROT	O43463 B2R6E8 B4DST0 Q53G60 Q6FHK6
PDB	3MTS
Pfam	PF00385 PF05033 PF00856
PROSITE	PS00598 PS50013 PS50868 PS50867 PS51579 PS50280
OMIM	300254
DisGeNET	6839

Histone-lysine N-methyltransferase SUV39H1 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 3MTS)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Interactions with other proteins (156 interactors)

Cross-References

Database

Links

Description

Description