Proline-serine-threonine phosphatase-interacting protein 1 - Homo sapiens

Proline-serine-threonine phosphatase-interacting protein 1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Proline-serine-threonine phosphatase-interacting protein 1
Accession Code	O43586
Gene	PSTPIP1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 416)
MMPQLQFKDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDMEELLRQRAQAEERYGKELVQIARKAGGQTEINSLRASFDSL KQQMENVGSSHIQLALTLREELRSLEEFRERQKEQRKKYEAVMDRVQKSKLSLYKKAMESKKTYEQKCRDADDAEQAFER ISANGHQKQVEKSQNKARQCKDSATEAERVYRQSIAQLEKVRAEWEQEHRTTCEAFQLQEFDRLTILRNALWVHSNQLSM QCVKDDELYEEVRLTLEGCSIDADIDSFIQAKSTGTEPPAPVPYQNYYDREVTPLTSSPGIQPSCGMIKRFSGLLHGSPK TTSLAASAASTETLTPTPERNEGVYTAIAVQEIQGNPASPAQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVE RNGQRGFVPGSYLEKL

Structure Viewer (PDB: 2DIL)

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:9857189}. Cell membrane {Experimental EvidencePubMed:18480402, Experimental EvidencePubMed:9857189}; Peripheral membrane protein {Experimental EvidencePubMed:9857189}. Cell projection, uropodium {Experimental EvidencePubMed:18480402}. Cytoplasm, cytoskeleton {ECO:0000269\|PubMed:19109554, ECO:0000269\|PubMed:19584923}. Cytoplasm, perinuclear region {ECO:0000250\|UniProtKB:P97814}. Cell projection, lamellipodium {ECO:0000250\|UniProtKB:P97814}. Cleavage furrow {ECO:0000250\|UniProtKB:P97814}. Note=Mainly cytoplasmic in T-cells (PubMed:9857189). Colocalizes in cluster with CD2 near the cell surface membrane in activated T-cells (PubMed:9857189). In monocytes, forms a branched filamentous network in the cytoplasm (PubMed:19584923). In transfected cells, forms relatively straight filaments radiating out from the nucleus (PubMed:19584923). Filament formation requires an intact tubulin cytoskeleton (PubMed:19584923). In migrating neutrophils, colocalizes with PIP5K1C and DNM2 to the trailing edge of the uropod in a actin-dependent manner (PubMed:18480402). Colocalized with PTPN12 in the cytoplasm and the perinuclear region. During interphase, colocalizes with F-actin in the cortical cytoskeleton, lamellipodia, and stress fibers. In dividing cells, colocalizes with the F-actin rich cytokinetic cleavage furrow. Colocalized with CD2AP and WAS in the actin cytoskeleton within the cytoplasm. Colocalized with CD2, CD2AP and WAS at the site of T-cell:APC contact (By similarity). {ECO:0000250\|UniProtKB:P97814, Experimental EvidencePubMed:18480402, ECO:0000269\|PubMed:19584923, Experimental EvidencePubMed:9857189}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Experimental Evidence {ECO:0000269\|PubMed:9857189}
Assigned Ontology terms

Cellular Component	Actin Filament (GO:0005884) Cleavage Furrow (GO:0032154) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Lamellipodium (GO:0030027) Membrane (GO:0016020) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Uropod (GO:0001931)

Biology & Function

Description
Involved in regulation of the actin cytoskeleton. May regulate WAS actin-bundling activity. Bridges the interaction between ABL1 and PTPN18 leading to ABL1 dephosphorylation. May play a role as a scaffold protein between PTPN12 and WAS and allow PTPN12 to dephosphorylate WAS. Has the potential to physically couple CD2 and CD2AP to WAS. Acts downstream of CD2 and CD2AP to recruit WAS to the T- cell:APC contact site so as to promote the actin polymerization required for synapse induction during T-cell activation (By similarity). Down-regulates CD2-stimulated adhesion through the coupling of PTPN12 to CD2. Also has a role in innate immunity and the inflammatory response. Recruited to inflammasomes by MEFV. Induces formation of pyroptosomes, large supramolecular structures composed of oligomerized PYCARD dimers which form prior to inflammatory apoptosis. Binding to MEFV allows MEFV to bind to PYCARD and facilitates pyroptosome formation. Regulates endocytosis and cell migration in neutrophils. {By Similarity, Experimental EvidencePubMed:17964261, Experimental EvidencePubMed:18480402, Experimental EvidencePubMed:19109554, Experimental EvidencePubMed:19584923, Experimental EvidencePubMed:9857189}.
Assigned Ontology terms

Biological Process	Actin Filament Polymerization (GO:0030041) Cell Adhesion (GO:0007155) Endocytosis (GO:0006897) Inflammatory Response (GO:0006954) Innate Immune Response (GO:0045087) Signal Transduction (GO:0007165)
Molecular Function	Actin Filament Binding (GO:0051015) Identical Protein Binding (GO:0042802)

Disease associations

Description
PAPA syndrome (PAPAS) [MIM:604416]: Characterized by autosomal dominant inheritance of early-onset, primarily affecting skin and joint tissues. Recurring inflammatory episodes lead to accumulation of sterile, pyogenic, neutrophil-rich material within the affected joints, ultimately resulting in significant destruction. {Experimental EvidencePubMed:11971877, Experimental EvidencePubMed:14595024, Experimental EvidencePubMed:22161697}. Note=The disease is caused by variants affecting the gene represented in this entry.
Database Associations
OMIM	604416 606347
DisGeNET	9051

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O43586	Self	EBI-14036224	0.59
Interactions with other proteins (93 interactors)

Partner (UniProt)		IntAct	Confidence score
P06729	T-cell surface antigen CD2 (Erythrocyte receptor) (LFA-2) (LFA-3 receptor) (Rosette receptor) (T-cell surface antigen T11/Leu-5) (CD antigen CD2)	EBI-8661989	0.74
P18031	Tyrosine-protein phosphatase non-receptor type 1 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1B) (PTP-1B)	EBI-8662139	0.40
Q05209	Tyrosine-protein phosphatase non-receptor type 12 (EC 3.1.3.48) (PTP-PEST) (Protein-tyrosine phosphatase G1) (PTPG1)	EBI-7086193	0.78
P42768	Actin nucleation-promoting factor WAS (Wiskott-Aldrich syndrome protein) (WASp)	EBI-7086234	0.46
P35831	Tyrosine-protein phosphatase non-receptor type 12 (EC 3.1.3.48) (MPTP-PEST) (Protein-tyrosine phosphatase P19) (P19-PTP)	EBI-7833624	0.40
Q53ZZ1	Tumor necrosis factor ligand superfamily member 6 (CD95 ligand) (Fas antigen ligand)	EBI-7833641	0.56
Q15058	Kinesin-like protein KIF14	EBI-1074843	0.00
Q9Y3U8	60S ribosomal protein L36 (Large ribosomal subunit protein eL36)	EBI-1074867	0.00
Q75MH1	40S ribosomal protein S26	EBI-1075090	0.00
Q7L1Q6	eIF5-mimic protein 2 (Basic leucine zipper and W2 domain-containing protein 1) (Protein Orf)	EBI-1076117	0.00
Q8IZX4	Transcription initiation factor TFIID subunit 1-like (TAF(II)210) (TBP-associated factor 1-like) (TBP-associated factor 210 kDa) (Transcription initiation factor TFIID 210 kDa subunit)	EBI-1076263	0.00
Q02543	60S ribosomal protein L18a (Large ribosomal subunit protein eL20)	EBI-1076932	0.00
P83881	60S ribosomal protein L36a (60S ribosomal protein L44) (Cell growth-inhibiting gene 15 protein) (Cell migration-inducing gene 6 protein) (Large ribosomal subunit protein eL42)	EBI-1077069	0.00
Q9Y6E2	eIF5-mimic protein 1 (Basic leucine zipper and W2 domain-containing protein 2)	EBI-1077189	0.00
P18077	60S ribosomal protein L35a (Cell growth-inhibiting gene 33 protein) (Large ribosomal subunit protein eL33)	EBI-1077313	0.00
P37268	Squalene synthase (SQS) (SS) (EC 2.5.1.21) (FPP:FPP farnesyltransferase) (Farnesyl-diphosphate farnesyltransferase) (Farnesyl-diphosphate farnesyltransferase 1)	EBI-1077329	0.00
P62899	60S ribosomal protein L31 (Large ribosomal subunit protein eL31)	EBI-1077641	0.00
P39023	60S ribosomal protein L3 (HIV-1 TAR RNA-binding protein B) (TARBP-B) (Large ribosomal subunit protein uL3)	EBI-1077784	0.00
Q76P68	60S ribosomal protein L12	EBI-1077945	0.00
Q99996	A-kinase anchor protein 9 (AKAP-9) (A-kinase anchor protein 350 kDa) (AKAP 350) (hgAKAP 350) (A-kinase anchor protein 450 kDa) (AKAP 450) (AKAP 120-like protein) (Centrosome- and Golgi-localized PKN-associated protein) (CG-NAP) (Protein hyperion) (Protein kinase A-anchoring protein 9) (PRKA9) (Protein yotiao)	EBI-1078222	0.00
P15924	Desmoplakin (DP) (250/210 kDa paraneoplastic pemphigus antigen)	EBI-1078302	0.00
P62910	60S ribosomal protein L32 (Large ribosomal subunit protein eL32)	EBI-1079276	0.00
P31939	Bifunctional purine biosynthesis protein ATIC (AICAR transformylase/inosine monophosphate cyclohydrolase) (ATIC) [Cleaved into: Bifunctional purine biosynthesis protein ATIC, N-terminally processed] [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase) (AICAR formyltransferase) (AICAR transformylase); Inosine 5'-monophosphate cyclohydrolase (IMP cyclohydrolase) (EC 3.5.4.10) (IMP synthase) (Inosinicase)]	EBI-1079436	0.00
Q9UMN6	Histone-lysine N-methyltransferase 2B (Lysine N-methyltransferase 2B) (EC 2.1.1.364) (Myeloid/lymphoid or mixed-lineage leukemia protein 4) (Trithorax homolog 2) (WW domain-binding protein 7) (WBP-7)	EBI-1080161	0.00
Q9UBS9	SUN domain-containing ossification factor (Membrane protein CH1) (Protein osteopotentia homolog) (SUN-like protein 1)	EBI-1080330	0.00
Q9BVP2	Guanine nucleotide-binding protein-like 3 (E2-induced gene 3 protein) (Novel nucleolar protein 47) (NNP47) (Nucleolar GTP-binding protein 3) (Nucleostemin)	EBI-1080978	0.00
Q9UKX3	Myosin-13 (Myosin heavy chain 13) (Myosin heavy chain, skeletal muscle, extraocular) (MyHC-EO) (Myosin heavy chain, skeletal muscle, laryngeal) (MyHC-IIL) (Superfast myosin)	EBI-1081139	0.00
P47914	60S ribosomal protein L29 (Cell surface heparin-binding protein HIP) (Large ribosomal subunit protein eL29)	EBI-1081333	0.00
P46779	60S ribosomal protein L28 (Large ribosomal subunit protein eL28)	EBI-1081646	0.00
Q9NR30	Nucleolar RNA helicase 2 (EC 3.6.4.13) (DEAD box protein 21) (Gu-alpha) (Nucleolar RNA helicase Gu) (Nucleolar RNA helicase II) (RH II/Gu)	EBI-1082024	0.00
P62750	60S ribosomal protein L23a (Large ribosomal subunit protein uL23)	EBI-1083637	0.00
P61254	60S ribosomal protein L26 (Large ribosomal subunit protein uL24)	EBI-1084016	0.00
Q9Y265	RuvB-like 1 (EC 3.6.4.12) (49 kDa TATA box-binding protein-interacting protein) (49 kDa TBP-interacting protein) (54 kDa erythrocyte cytosolic protein) (ECP-54) (INO80 complex subunit H) (Nuclear matrix protein 238) (NMP 238) (Pontin 52) (TIP49a) (TIP60-associated protein 54-alpha) (TAP54-alpha)	EBI-1084371	0.00
Q9UJX6	Anaphase-promoting complex subunit 2 (APC2) (Cyclosome subunit 2)	EBI-1084500	0.00
Q96LW2	Ribosomal protein S6 kinase-related protein (EC 2.7.11.1) (Sugen kinase 494)	EBI-1085766	0.00
P49207	60S ribosomal protein L34 (Large ribosomal subunit protein eL34)	EBI-1085840	0.00
P05408	Neuroendocrine protein 7B2 (Pituitary polypeptide) (Secretogranin V) (Secretogranin-5) (Secretory granule endocrine protein I) [Cleaved into: N-terminal peptide; C-terminal peptide]	EBI-1085888	0.00
P42766	60S ribosomal protein L35 (Large ribosomal subunit protein uL29)	EBI-1085896	0.00
P61513	60S ribosomal protein L37a (Large ribosomal subunit protein eL43)	EBI-1085944	0.00
Q9H204	Mediator of RNA polymerase II transcription subunit 28 (Endothelial-derived protein 1) (Mediator complex subunit 28) (Merlin and Grb2-interacting cytoskeletal protein) (Magicin) (Tumor angiogenesis marker EG-1)	EBI-6966600	0.40
P48023	Tumor necrosis factor ligand superfamily member 6 (Apoptosis antigen ligand) (APTL) (CD95 ligand) (CD95-L) (Fas antigen ligand) (Fas ligand) (FasL) (CD antigen CD178) [Cleaved into: Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor necrosis factor ligand superfamily member 6, soluble form (Receptor-binding FasL ectodomain) (Soluble Fas ligand) (sFasL); ADAM10-processed FasL form (APL); FasL intracellular domain (FasL ICD) (SPPL2A-processed FasL form) (SPA)]	EBI-7908782	0.70
Q9ULH1	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein) (ADP-ribosylation factor-directed GTPase-activating protein 1) (ARF GTPase-activating protein 1) (Development and differentiation-enhancing factor 1) (DEF-1) (Differentiation-enhancing factor 1) (PIP2-dependent ARF1 GAP)	EBI-8492005	0.44
Q96B02	Ubiquitin-conjugating enzyme E2 W (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme W) (N-terminal E2 ubiquitin-conjugating enzyme) (EC 2.3.2.25) (N-terminus-conjugating E2) (Ubiquitin carrier protein W) (Ubiquitin-conjugating enzyme 16) (UBC-16) (Ubiquitin-protein ligase W)	EBI-8652722	0.67
Q99952	Tyrosine-protein phosphatase non-receptor type 18 (EC 3.1.3.48) (Brain-derived phosphatase)	EBI-8674047	0.60
Q9Y2R2	Tyrosine-protein phosphatase non-receptor type 22 (EC 3.1.3.48) (Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP) (Lymphoid phosphatase) (LyP) (PEST-domain phosphatase) (PEP)	EBI-9635611	0.59
Q8WWY3	U4/U6 small nuclear ribonucleoprotein Prp31 (Pre-mRNA-processing factor 31) (Serologically defined breast cancer antigen NY-BR-99) (U4/U6 snRNP 61 kDa protein) (Protein 61K) (hPrp31)	EBI-10177198	0.81
O00560	Syntenin-1 (Melanoma differentiation-associated protein 9) (MDA-9) (Pro-TGF-alpha cytoplasmic domain-interacting protein 18) (TACIP18) (Scaffold protein Pbp1) (Syndecan-binding protein 1)	EBI-10179805	0.56
O43684	Mitotic checkpoint protein BUB3	EBI-10185162	0.56
O75386	Tubby-related protein 3 (Tubby-like protein 3)	EBI-10188060	0.72
Q14D33	Receptor-transporting protein 5 (3CxxC-type zinc finger protein 5) (CXXC-type zinc finger protein 11)	EBI-10234854	0.72
Q86YD7	Protein FAM90A1	EBI-10260742	0.72
Q96D16	FBXL18 protein	EBI-10284292	0.56
Q9H788	SH2 domain-containing protein 4A (Protein SH(2)A) (Protein phosphatase 1 regulatory subunit 38)	EBI-10308355	0.56
Q9UQ90	Paraplegin (EC 3.4.24.-) (Cell matrix adhesion regulator) (Spastic paraplegia 7 protein)	EBI-10324798	0.56
Q9Y228	TRAF3-interacting JNK-activating modulator (TRAF3-interacting protein 3)	EBI-10325346	0.56
Q9Y473	Zinc finger protein 175 (Zinc finger protein OTK18)	EBI-10328034	0.56
Q9Y4Z0	U6 snRNA-associated Sm-like protein LSm4 (Glycine-rich protein) (GRP)	EBI-10328518	0.72
Q9Y5E9	Protocadherin beta-14 (PCDH-beta-14)	EBI-10329011	0.72
Q9ULZ3	Apoptosis-associated speck-like protein containing a CARD (hASC) (Caspase recruitment domain-containing protein 5) (PYD and CARD domain-containing protein) (Target of methylation-induced silencing 1)	EBI-10687267	0.35
X5D7R7	Major vault protein isoform G	EBI-21250457	0.37
X5DP17	Major vault protein isoform H	EBI-21250665	0.37
Q06630	Mitochondrial homologous recombination protein 1 (Cross-linked transcription component 1) (Mitochondrial large ribosomal subunit protein mL67)	EBI-11535799	0.56
Q12446	Proline-rich protein LAS17	EBI-11537414	0.56
O15169	Axin-1 (Axis inhibition protein 1) (hAxin)	EBI-16433147	0.56
P28702	Retinoic acid receptor RXR-beta (Nuclear receptor subfamily 2 group B member 2) (Retinoid X receptor beta)	EBI-16433157	0.56
A0A0S2Z5X4	Zinc finger protein 688 isoform 4	EBI-16433167	0.56
Q15287	RNA-binding protein with serine-rich domain 1 (SR-related protein LDC2)	EBI-24284068	0.56
Q2TBE0	CWF19-like protein 2	EBI-24284949	0.56
P00540	Proto-oncogene serine/threonine-protein kinase mos (EC 2.7.11.1) (Oocyte maturation factor mos) (Proto-oncogene c-Mos)	EBI-24284835	0.56
P17752	Tryptophan 5-hydroxylase 1 (EC 1.14.16.4) (Tryptophan 5-monooxygenase 1)	EBI-24289405	0.56
O75031	Heat shock factor 2-binding protein	EBI-24292215	0.56
Q96GM5	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (60 kDa BRG-1/Brm-associated factor subunit A) (BRG1-associated factor 60A) (BAF60A) (SWI/SNF complex 60 kDa subunit)	EBI-24293673	0.56
Q9BWG6	Sodium channel modifier 1	EBI-24314943	0.56
Q8IX18	Probable ATP-dependent RNA helicase DHX40 (EC 3.6.4.13) (DEAH box protein 40) (Protein PAD)	EBI-24324802	0.56
Q03014	Hematopoietically-expressed homeobox protein HHEX (Homeobox protein HEX) (Homeobox protein PRH)	EBI-24335840	0.56
Q53FD0	Zinc finger C2HC domain-containing protein 1C	EBI-24343226	0.56
Q9UK33	Zinc finger protein 580 (LDL-induced EC protein)	EBI-25244547	0.56
Q09161	Nuclear cap-binding protein subunit 1 (80 kDa nuclear cap-binding protein) (CBP80) (NCBP 80 kDa subunit)	EBI-25257106	0.56
Q9GZV7	Hyaluronan and proteoglycan link protein 2 (Brain link protein 1)	EBI-24487515	0.56
P0CG20	Proline-rich protein 35 (Uncharacterized protein RJD1)	EBI-24493428	0.56
Q14005	Pro-interleukin-16 [Cleaved into: Interleukin-16 (IL-16) (Lymphocyte chemoattractant factor) (LCF)]	EBI-24503632	0.56
P32969	60S ribosomal protein L9 (Large ribosomal subunit protein uL6)	EBI-24399253	0.56
Q96GY3	Protein lin-37 homolog (Antolefinin)	EBI-24405719	0.56
Q3SY00	Testis-specific protein 10-interacting protein (Tsga10-interacting protein)	EBI-24420123	0.56
Q96T60	Bifunctional polynucleotide phosphatase/kinase (DNA 5'-kinase/3'-phosphatase) (Polynucleotide kinase-3'-phosphatase) [Includes: Polynucleotide 3'-phosphatase (EC 3.1.3.32) (2'(3')-polynucleotidase); Polynucleotide 5'-hydroxyl-kinase (EC 2.7.1.78)]	EBI-24424643	0.56
Q08426	Peroxisomal bifunctional enzyme (PBE) (PBFE) (L-bifunctional protein) (LBP) (Multifunctional enzyme 1) (MFE1) [Includes: Enoyl-CoA hydratase/3,2-trans-enoyl-CoA isomerase (EC 4.2.1.17) (EC 5.3.3.8); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35)]	EBI-24429413	0.56
Q96EZ8	Microspherule protein 1 (58 kDa microspherule protein) (Cell cycle-regulated factor p78) (INO80 complex subunit J) (MCRS2)	EBI-24473920	0.56
Q9H9D4	Zinc finger protein 408 (PR domain zinc finger protein 17)	EBI-24475818	0.56
Q63ZY3	KN motif and ankyrin repeat domain-containing protein 2 (Ankyrin repeat domain-containing protein 25) (Matrix-remodeling-associated protein 3) (SRC-1-interacting protein) (SIP) (SRC-interacting protein) (SRC1-interacting protein)	EBI-24476422	0.56
O15553	Pyrin (Marenostrin)	EBI-14036141	0.58
P16403	Histone H1.2 (Histone H1c) (Histone H1d) (Histone H1s-1)	EBI-20919468	0.40
O43390	Heterogeneous nuclear ribonucleoprotein R (hnRNP R)	EBI-20927592	0.40
O14672	Disintegrin and metalloproteinase domain-containing protein 10 (ADAM 10) (EC 3.4.24.81) (CDw156) (Kuzbanian protein homolog) (Mammalian disintegrin-metalloprotease) (CD antigen CD156c)	EBI-21225540	0.40

Cross-References

Database	Links
UNIPROT	O43586 B5BU74 B5BUK4 O43585 O95657
PDB	2DIL 7AAL 7AAM 7AAN
Pfam	PF00611 PF14604
PROSITE	PS51741 PS50002
OMIM	604416 606347
DisGeNET	9051

Proline-serine-threonine phosphatase-interacting protein 1 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 2DIL)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Disease associations

Description

Database Associations

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Interactions with other proteins (93 interactors)

Cross-References

Database

Links

Description

Description