NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Arachidonate 12-lipoxygenase, 12R-type - Mus musculus - NucEnvDB

Arachidonate 12-lipoxygenase, 12R-type (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Arachidonate 12-lipoxygenase, 12R-type
Accession Code	O70582
Gene	Alox12b
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 701)
MATYKVKVATGTDFFSGTLDSISLTIVGTQGESHKQRLNHFGRDFATGAVDDYTVQCQQDLGELIIIRLHKEPHSFLAKDPWYCNYVQICAPDCRVYHFPAYQWMDGYETLALREATGKITADDTLPILL EHRQEEIRAKKDFYHWRVFVPGLPNYVDIPSYHPPPRRCRNPNRPEWDGYIPGFPILINIKATRFLNSNLRFSFVKTASFFYRLGPMALAFKLRGLVDRKRSWKRLKDIKNIFPATKSVVSEYVAEHWTE DSFFGYQYLNGINPGLIRRCTQIPDKFPVTDEMVAPFLGEGTCLQAELERGNIYLADYRILDGIPTVELNGQQQHHCAPMCLLHFGPDGNMMPIAIQLSQTPGPDCPIFLPNDSEWDWLLAKTWVRYAEF YSHEAVAHLLESHLIGEAFCLALLRNLPMCHPLYKLLIPHTRYNVQINSIGRALLLNKGGLSARAMSLGLEGFAQVMVRGLSELTYKSLCIPNDFVERGVQDLPGYYFRDDSLAVWYAMERYVTEIITYY YPNDAAVEGDPELQCWVQEIFKECLLGRESSGFPTCLRTIPELIEYVTMVMYTCSARHAAVNSGQLEYTSWMPNFPSSMRNPPMQTKGLTTLQTYMDTLPDVKTTCIVLLVLWTLCREPDDRRPLGHFPD IHFVEEGPRRSIEAFRQNLNQISHNIRQRNKCLTLPYYYLDPVLIENSISI

Subcellular Location

Description
Cytoplasm {Sequence AnalysisPROSITE-ProRule:PRU00726}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:9837935}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytosol (GO:0005829) Intracellular Membrane-Bounded Organelle (GO:0043231) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Catalyzes the regio and stereo-specific incorporation of a single molecule of dioxygen into free and esterified polyunsaturated fatty acids generating lipid hydroperoxides that can be further reduced to the corresponding hydroxy species (PubMed:16129665). Does not convert arachidonic acid to (12R)-hydroperoxyeicosatetraenoic acid/(12R)-HPETE (PubMed:10100631, PubMed:11256953). In the skin, acts upstream of ALOXE3 on the lineolate moiety of esterified omega- hydroxyacyl-sphingosine (EOS) ceramides to produce an epoxy-ketone derivative, a crucial step in the conjugation of omega-hydroxyceramide to membrane proteins. Therefore plays a crucial role in the synthesis of corneocytes lipid envelope and the establishment of the skin barrier to water loss (PubMed:17403930, PubMed:17429434, PubMed:21558561). May also play a role in the regulation of the expression of airway mucins (By similarity). {By SimilarityUniProtKB:O75342, Experimental EvidencePubMed:10100631, Experimental EvidencePubMed:11256953, Experimental EvidencePubMed:16129665, Experimental EvidencePubMed:17403930, Experimental EvidencePubMed:17429434, Experimental EvidencePubMed:21558561}.
Assigned Ontology terms

Biological Process	Arachidonic Acid Metabolic Process (GO:0019369) Ceramide Biosynthetic Process (GO:0046513) Establishment Of Skin Barrier (GO:0061436) Hepoxilin Biosynthetic Process (GO:0051122) Linoleic Acid Metabolic Process (GO:0043651) Lipid Oxidation (GO:0034440) Lipoxygenase Pathway (GO:0019372) Positive Regulation Of Gene Expression (GO:0010628) Positive Regulation Of MAPK Cascade (GO:0043410) Positive Regulation Of Mucus Secretion (GO:0070257) Protein Lipidation (GO:0006497) Sphingolipid Metabolic Process (GO:0006665)
Molecular Function	Arachidonate 12(R)-Lipoxygenase Activity (GO:0106237) Arachidonate 12(S)-Lipoxygenase Activity (GO:0004052) Arachidonate 8(R)-Lipoxygenase Activity (GO:0047677) Catalytic Activity (GO:0003824) Iron Ion Binding (GO:0005506) Linoleate 9S-Lipoxygenase Activity (GO:1990136) Oxidoreductase Activity, Acting On Single Donors With Incorporation Of Molecular Oxygen, Incorporation Of Two Atoms Of Oxygen (GO:0016702)

Cross-References

Database	Links
UNIPROT	O70582
Pfam	PF00305 PF01477
PROSITE	PS00711 PS00081 PS51393 PS50095

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK