NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Gamma-synuclein - Homo sapiens - NucEnvDB

Gamma-synuclein (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Gamma-synuclein
Accession Code	O76070
Gene	SNCG
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 127)
MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

Subcellular Location

Description
Cytoplasm, perinuclear region {Experimental EvidencePubMed:11746666}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {Experimental EvidencePubMed:11746666}. Cytoplasm, cytoskeleton, spindle {Experimental EvidencePubMed:11746666}. Note=Associated with centrosomes in several interphase cells. In mitotic cells, localized to the poles of the spindle.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Axon Terminus (GO:0043679) Cytoplasm (GO:0005737) Extracellular Exosome (GO:0070062) Microtubule Organizing Center (GO:0005815) Neuronal Cell Body (GO:0043025) Perinuclear Region Of Cytoplasm (GO:0048471) Spindle (GO:0005819)

Biology & Function

Description
Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases (By similarity). May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway (By similarity). {By Similarity}.
Assigned Ontology terms

Biological Process	Adult Locomotory Behavior (GO:0008344) Chemical Synaptic Transmission (GO:0007268) Protein Secretion (GO:0009306) Regulation Of Dopamine Secretion (GO:0014059) Regulation Of Neuron Death (GO:1901214) Regulation Of Neurotransmitter Secretion (GO:0046928) Synapse Organization (GO:0050808) Synaptic Vesicle Endocytosis (GO:0048488)
Molecular Function	Cuprous Ion Binding (GO:1903136)

Protein-Protein Interactions

Interactions with other proteins (16 interactors)

Partner (UniProt)		IntAct	Confidence score
Q93063	Exostosin-2 (EC 2.4.1.224) (EC 2.4.1.225) (Glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase) (Multiple exostoses protein 2) (Putative tumor suppressor protein EXT2)	EBI-1060980	0.00
P25205	DNA replication licensing factor MCM3 (EC 3.6.4.12) (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) (RLF subunit beta) (p102)	EBI-1061588	0.00
A6NEW6	Protein FAM90A16	EBI-1061794	0.00
P41235	Hepatocyte nuclear factor 4-alpha (HNF-4-alpha) (Nuclear receptor subfamily 2 group A member 1) (Transcription factor 14) (TCF-14) (Transcription factor HNF-4)	EBI-1062596	0.00
Q96AE4	Far upstream element-binding protein 1 (FBP) (FUSE-binding protein 1) (DNA helicase V) (hDH V)	EBI-1063260	0.00
P17844	Probable ATP-dependent RNA helicase DDX5 (EC 3.6.4.13) (DEAD box protein 5) (RNA helicase p68)	EBI-1063704	0.00
P26038	Moesin (Membrane-organizing extension spike protein)	EBI-1064569	0.00
P63167	Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN)	EBI-1066918	0.00
P63162	Small nuclear ribonucleoprotein-associated protein N (snRNP-N) (Sm protein D) (Sm-D) (Sm protein N) (Sm-N) (SmN) (Tissue-specific-splicing protein)	EBI-1070602	0.00
P15090	Fatty acid-binding protein, adipocyte (Adipocyte lipid-binding protein) (ALBP) (Adipocyte-type fatty acid-binding protein) (A-FABP) (AFABP) (Fatty acid-binding protein 4)	EBI-1077459	0.00
P16035	Metalloproteinase inhibitor 2 (CSC-21K) (Tissue inhibitor of metalloproteinases 2) (TIMP-2)	EBI-1082630	0.00
E9QKK1	Centromere-associated protein E	EBI-10995761	0.35
P36895	Bone morphogenetic protein receptor type-1A (BMP type-1A receptor) (BMPR-1A) (EC 2.7.11.30) (Activin receptor-like kinase 3) (ALK-3) (BMP-2/BMP-4 receptor) (Serine/threonine-protein kinase receptor R5) (SKR5) (CD antigen CD292)	EBI-11008521	0.35
P54274	Telomeric repeat-binding factor 1 (NIMA-interacting protein 2) (TTAGGG repeat-binding factor 1) (Telomeric protein Pin2/TRF1)	EBI-11308211	0.51
Q9NYB0	Telomeric repeat-binding factor 2-interacting protein 1 (TERF2-interacting telomeric protein 1) (TRF2-interacting telomeric protein 1) (Dopamine receptor-interacting protein 5) (Repressor/activator protein 1 homolog) (RAP1 homolog) (hRap1)	EBI-11308221	0.37
Q9NUX5	Protection of telomeres protein 1 (hPot1) (POT1-like telomere end-binding protein)	EBI-11308231	0.37

Cross-References

Database	Links
UNIPROT	O76070 O15104 Q96P61
Pfam	PF01387
OMIM	602998
DisGeNET	6623

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK