Interaptin - Dictyostelium discoideum

Interaptin (Dictyostelium discoideum)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Interaptin
Accession Code	O76329
Gene	abpD
Organism	Dictyostelium discoideum (Taxonomy: 44689)
Part of Reference Proteome?	Yes
Sequence (Length: 1738)
MEHSTPLNEEIVHKKNDENWVIAQKKVFTNWCNIFLNQRSQKIEDLETDLYDGILLGSLLEILSGKNVILSKCKQLKTRLHYINNLNFSLKFIGDEGLRLVGVASEDITDGNLKLILGLVWTLILRYQIQ SMQNSKSSQQNLHSSTKPSELMLNWVKSQISDYGHHIKDLTTSFQNGLLFCALVHKLVPEKLDYKSLSESDSLGNLTLAFEVANKELGIPSILDPHDIITTPDELSILTYISLFPKVYQQTLEPLNNNNN ISPSLSSSSSSLLNTPNKRNSIQLSKSTSFEQQNQQQQQQNLLSPNSYRNSISFSKSPSFEGSQSTGSSRSISPISSPIKNSTTGNSNLSKSTSFEKIEASNTTNNNTIIIAEESRVIEKIVEKIIEVEK IVEVEKIVEVEKIVEVEKIVEVEKIVKVDDIEKLTNLQDQLTEQQQQYQEKSLKLVNLELELQEKSNQLVDKSNQLSTMQATNSELMEKIGGLMNDLTDIPTQDIKEKDEIIANLKIESEKNLKCFQDDF NALQSRYSLTIEQTSQLQDRIKQLINELQERDDKFIEFTNSSNQSLADNQRVIDQLTNEKQSITLQLQDQQDIKEKEFQFEKQQLLSQIDSITTNIQEYQDKFNNLQQEFNTQQTLNQQETHRLTQQLYQ INTDYNEKQTQLQSEIKDNQTINEQLNKQLSEKDKEIEKLSNQQEQQQDEKINNLLLEIKEKDCLIERINQQLLENIDLNSKYQQLLLEFENFKLNSSKEKENQLNELQSKQDERFNQLNDEKLEKEKQL QSIEDEFNQYKQQQLSSNSNIDQQLQSTIIELSELKEQKELNDSKLIEKEKQLQQLQQEFDQLNEKNQKDHQDQLELLEKQLKQLQQEYDQLNETNQSIENQLNQQNLINKENLNEKEQELLKLQNQLNQ QIEKIQFDQQEFSKQNSINIELVNEKNEKLIQLQQDYDQLKQQNRSNDEKDENDLIEKENQLKSIQNELNQLIEKNESDHKEQQLKQQSIENDLIEKENQIQQLQSQLNEQRQQQSNQLSEKDQQLNQLI EKNQFDQKEQQLKQQSIENDLFEKENQIQQLQSQLNEQRQQQSNQLSEKDQQLNQLIEKNESDQKEQQLKQQSIENDLIEKENQIQQLQLQLNEQRQLQSEVSIDNDKILELEKQLKQCQSDLLKLNDEK QQQDKQLQDKQIEFDQLQLTFNQFKNDKDSQFIQLQDDQKQQLQSIQQDLNQLKQENQEKEKQLSEKDEKLQSIQFENQEKEKQLSEKDEKLQSIQQNLNQLNDENQEKVKQFSEKDEKLQSIQQDLNQL KQENQEKEKQLSEKDEKLQSIQQDLNQLNDDQIKKNEKLKEKEEQLLKLQQDFNDQQSQQLKQLEEKLSEKENQLQQLKQENEINQLNQQQQSNEIIQQLKDQLLKQQQQEQQENNNEKEIERLIQEIEQ LKQQQEIDQSELSNKEIKIQTTQQEFDQLSHNRSKDQLHLQQLQQELDQLKQSFDDQDHQFKKVIDERYNLQLQLEQSTLSNNQLDQLLKEKLKPLELDSNEKQKTIDDLLSNISNLQISLQNDKDLISE RNNSIKTLESRITQQLSLLDEKDNLIKDLQQQKQQQQQPPTASSSPSSSPSLLSSTPTPKPQRPNQIEIDRLVNEIVNRNQDLIRKNKTKFYKLENGDYIVNSIIYRLSLDDDNDSDLIAQEYENGNSTT FEKSLRIFPSKNTRPIFDWRALFFIGAAVLAISTLFSSSRPIKYEKPT

Subcellular Location

Description
Nucleus membrane; Single-pass type IV membrane protein; Cytoplasmic side. Endoplasmic reticulum membrane. Golgi apparatus, Golgi stack membrane. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Note=The largest part of the protein is cytoplasmic, while its C-terminal part is associated either with the nuclear envelope, the Golgi membrane or the endoplasmic reticulum membrane.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Endoplasmic Reticulum Membrane (GO:0005789) Golgi Cisterna Membrane (GO:0032580) Microtubule Organizing Center (GO:0005815) Nuclear Envelope (GO:0005635) Nuclear Membrane (GO:0031965) Nuclear Outer Membrane-Endoplasmic Reticulum Membrane Network (GO:0042175)

Biology & Function

Description
May function as linker between cellular membranes and the actin cytoskeleton. Required for normal development of fruiting bodies. {Experimental EvidencePubMed:10704840}.
Assigned Ontology terms

Biological Process	Cell-Cell Adhesion (GO:0098609) Sorocarp Development (GO:0030587) Spore Germination (GO:0009847)
Molecular Function	Actin Binding (GO:0003779)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q86HW7	Nuclear transport factor 2	EBI-922911	0.40
Interactions with other proteins (64 interactors)

Partner (UniProt)		IntAct	Confidence score
Q54CH1	Arrestin domain-containing protein A	EBI-922911	0.40
Q55FK4	Acyl-protein thioesterase 1 homolog 2 (EC 3.1.2.-) (Palmitoyl-protein hydrolase) (EC 3.1.2.22)	EBI-922911	0.40
Q55CS9	ATP synthase subunit beta, mitochondrial (EC 7.1.2.2) (ATP synthase F1 subunit beta)	EBI-922911	0.40
Q23858	Calreticulin	EBI-922911	0.40
P34122	cAMP-binding protein 2 (CABP-2) (CABP1-related protein p31/p34)	EBI-922911	0.40
P25870	Clathrin heavy chain	EBI-922911	0.40
P34121	Coactosin (Cyclic AMP-regulated protein p16) (Cytoskeletal protein p17)	EBI-922911	0.40
Q54HL0	Coatomer subunit gamma (Gamma-coat protein) (Gamma-COP)	EBI-922911	0.40
Q54KG1	Probable ATP-dependent RNA helicase ddx41 (EC 3.6.4.13) (DEAD box protein 41)	EBI-922911	0.40
Q54T81	Probable H/ACA ribonucleoprotein complex subunit 4 (EC 5.4.99.-)	EBI-922911	0.40
Q54NB6	FK506-binding protein 4 (EC 5.2.1.8) (Histone proline isomerase) (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase)	EBI-922911	0.40
P46800	Guanine nucleotide-binding protein subunit beta-like protein	EBI-922911	0.40
Q552M5	Ras guanine nucleotide exchange factor Y (RasGEF domain-containing protein Y)	EBI-922911	0.40
Q557E0	Heat shock cognate 70 kDa protein 2 (HSC70-2)	EBI-922911	0.40
P54651	Heat shock cognate 90 kDa protein	EBI-922911	0.40
Q55GF9	Inner centromere protein A (DdINCENP)	EBI-922911	0.40
Q6RZZ9	Kinesin-related protein 13 (Kinesin family member 13) (Kinesin-5)	EBI-922911	0.40
Q54BF6	Mitochondrial substrate carrier family protein N (Solute carrier family 25 member 3 homolog)	EBI-922911	0.40
P34118	Major vault protein alpha (MVP-alpha)	EBI-922911	0.40
Q869Y7	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (OGDC-E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex)	EBI-922911	0.40
Q23921	Protein pkiA (Protein DD-1)	EBI-922911	0.40
Q54JM5	26S proteasome non-ATPase regulatory subunit 1	EBI-922911	0.40
Q54BH4	RING-type domain-containing protein	EBI-922911	0.40
Q54BP1	GRIP domain-containing protein	EBI-922911	0.40
Q54DL5	GATA zinc finger domain-containing protein 14	EBI-922911	0.40
Q54FU0	ADF-H domain-containing protein	EBI-922911	0.40
Q54G01	TPR_MLP1_2 domain-containing protein	EBI-922911	0.40
Q54G31	DUF3883 domain-containing protein	EBI-922911	0.40
Q54GS4	Rho_N domain-containing protein	EBI-922911	0.40
Q54GY1	PX domain-containing protein	EBI-922911	0.40
Q54H23	Lysosomal Pro-X carboxypeptidase	EBI-922911	0.40
Q54I73	Conserved oligomeric Golgi complex subunit 4	EBI-922911	0.40
Q54NB4	RRM domain-containing protein	EBI-922911	0.40
Q54R55	Cathepsin X (EC 3.4.18.1)	EBI-922911	0.40
Q54RZ4	BB_PF domain-containing protein	EBI-922911	0.40
Q54SP3	Polyubiquitin-A [Cleaved into: Ubiquitin; Ubiquitin-related 1]	EBI-922911	0.40
Q54TQ6	Phage protein	EBI-922911	0.40
Q54U97	Phage protein	EBI-922911	0.40
Q54U98	Inner membrane protein	EBI-922911	0.40
Q54VJ7	Uncharacterized protein	EBI-922911	0.40
Q54VQ1	Heat shock protein	EBI-922911	0.40
Q54W02	G8 domain-containing protein	EBI-922911	0.40
Q54XP9	RING-type domain-containing protein	EBI-922911	0.40
Q556V8	Dyp-type peroxidase	EBI-922911	0.40
Q55CE3	ZZ-type domain-containing protein	EBI-922911	0.40
Q55CZ0	Por_Secre_tail domain-containing protein	EBI-922911	0.40
Q55DZ5	Polyubiquitin-A [Cleaved into: Ubiquitin; Ubiquitin-related 1]	EBI-922911	0.40
Q55F82	DOMON domain-containing protein	EBI-922911	0.40
Q55F84	Helicase ATP-binding domain-containing protein	EBI-922911	0.40
Q55GC0	Methyltransf_11 domain-containing protein	EBI-922911	0.40
Q55GC5	PLAT domain-containing protein	EBI-922911	0.40
Q75JY8	Actin binding protein	EBI-922911	0.40
P33519	GTP-binding nuclear protein Ran (GTPase Ran) (Ras-like protein TC4) (Ras-related nuclear protein)	EBI-922911	0.40
Q86K01	60S ribosomal protein L15	EBI-922911	0.40
Q559R0	GTP-binding protein Sar1A	EBI-922911	0.40
P52285	SCF ubiquitin ligase complex protein SKP1a (Glycoprotein FP21 isoform A) [Cleaved into: SCF ubiquitin ligase complex protein SKP1a(4-162); SCF ubiquitin ligase complex protein SKP1a(6-162)]	EBI-922911	0.40
Q95ZG4	Spindle pole body component 98 (DdSpc98) (Spc98)	EBI-922911	0.40
P32255	Tubulin alpha chain (EC 3.6.5.-) (Alpha-tubulin)	EBI-922911	0.40
P32256	Tubulin beta chain (Beta-tubulin)	EBI-922911	0.40
Q55AR3	Tubulin gamma chain (Gamma-tubulin)	EBI-922911	0.40
Q54TH8	T-complex protein 1 subunit gamma (TCP-1-gamma) (CCT-gamma)	EBI-922911	0.40
Q54LP7	Ubiquitin-conjugating enzyme E2 J2 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme J2)	EBI-922911	0.40
Q54WN5	U3 small nucleolar RNA-associated protein 6 homolog	EBI-922911	0.40
Q55EX9	Putative methyltransferase DDB_G0268948 (EC 2.1.1.-)	EBI-922911	0.40

Cross-References

Database	Links
UNIPROT	O76329 Q54KE8
Pfam	PF00307
PROSITE	PS00019 PS00020 PS50021

Interaptin (Dictyostelium discoideum)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Interactions with other proteins (64 interactors)

Cross-References

Database

Links

Description

Description