NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Tyrosine 3-monooxygenase - Rattus norvegicus - NucEnvDB

Tyrosine 3-monooxygenase (Rattus norvegicus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Tyrosine 3-monooxygenase
Accession Code	P04177
Gene	Th
Organism	Rattus norvegicus \| Norway rat (Taxonomy: 10116)
Part of Reference Proteome?	Yes
Sequence (Length: 498)
MPTPSAPSPQPKGFRRAVSEQDAKQAEAVTSPRFIGRRQSLIEDARKEREAAAAAAAAAVASSEPGNPLEAVVFEERDGN AVLNLLFSLRGTKPSSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSAR EDKVPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQVYRQRRKLIAEIAFQYKHGEPIPHVEYTAEEIATWKEVYVTL KGLYATHACREHLEGFQLLERYCGYREDSIPQLEDVSRFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASS PMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTVYWFTVEFGLCKQNGELKAYGAGLLSSYGEL LHSLSEEPEVRAFDPDTAAVQPYQDQTYQPVYFVSESFNDAKDKLRNYASRIQRPFSVKFDPYTLAIDVLDSPHTIQRSL EGVQDELHTLAHALSAIS

Structure Viewer (PDB: 2MDA)

Subcellular Location

Description
Cytoplasm, perinuclear region {By SimilarityUniProtKB:P24529}. Nucleus {Experimental EvidencePubMed:21392500}. Cell projection, axon {By SimilarityUniProtKB:P24529}. Cytoplasm {Experimental EvidencePubMed:15496595, Experimental EvidencePubMed:21392500}. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle {Experimental EvidencePubMed:15496595}. Note=When phosphorylated at Ser-19 shows a nuclear distribution and when phsphorylated at Ser-31 as well at Ser- 40 shows a cytosolic distribution (PubMed:21392500). Expressed in dopaminergic axons and axon terminals (By similarity). {ECO:0000250\|UniProtKB:P07101, Experimental EvidencePubMed:21392500}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Anchoring Junction (GO:0070161) Axon (GO:0030424) Cytoplasm (GO:0005737) Cytoplasmic Side Of Plasma Membrane (GO:0009898) Cytoplasmic Vesicle (GO:0031410) Cytoplasmic Vesicle Membrane (GO:0030659) Cytosol (GO:0005829) Dendrite (GO:0030425) Melanosome Membrane (GO:0033162) Mitochondrion (GO:0005739) Neuron Projection (GO:0043005) Neuronal Cell Body (GO:0043025) Nucleus (GO:0005634) Perikaryon (GO:0043204) Perinuclear Region Of Cytoplasm (GO:0048471) Smooth Endoplasmic Reticulum (GO:0005790) Synaptic Vesicle (GO:0008021) Terminal Bouton (GO:0043195)

Biology & Function

Description
Catalyzes the conversion of L-tyrosine to L- dihydroxyphenylalanine (L-Dopa), the rate-limiting step in the biosynthesis of cathecolamines, dopamine, noradrenaline, and adrenaline. Uses tetrahydrobiopterin and molecular oxygen to convert tyrosine to L-Dopa (By similarity). In addition to tyrosine, is able to catalyze the hydroxylation of phenylalanine and tryptophan but with lower specificity (PubMed:11922614, PubMed:10933781). Positively regulates the regression of retinal hyaloid vessels during postnatal development (By similarity). {By SimilarityUniProtKB:P07101, By SimilarityUniProtKB:P24529, Experimental EvidencePubMed:10933781, Experimental EvidencePubMed:11922614}.
Assigned Ontology terms

Biological Process	Aminergic Neurotransmitter Loading Into Synaptic Vesicle (GO:0015842) Animal Organ Morphogenesis (GO:0009887) Catecholamine Biosynthetic Process (GO:0042423) Cellular Response To Alkaloid (GO:0071312) Cellular Response To Glucose Stimulus (GO:0071333) Cellular Response To Growth Factor Stimulus (GO:0071363) Cellular Response To Manganese Ion (GO:0071287) Cellular Response To Nicotine (GO:0071316) Cellular Response To Xenobiotic Stimulus (GO:0071466) Cerebral Cortex Development (GO:0021987) Circadian Sleep/Wake Cycle (GO:0042745) Cognition (GO:0050890) Dopamine Biosynthetic Process (GO:0042416) Dopamine Biosynthetic Process From Tyrosine (GO:0006585) Eating Behavior (GO:0042755) Embryonic Camera-Type Eye Morphogenesis (GO:0048596) Epinephrine Biosynthetic Process (GO:0042418) Eye Photoreceptor Cell Development (GO:0042462) Fatty Acid Metabolic Process (GO:0006631) Glycoside Metabolic Process (GO:0016137) Heart Development (GO:0007507) Hyaloid Vascular Plexus Regression (GO:1990384) Isoquinoline Alkaloid Metabolic Process (GO:0033076) Learning (GO:0007612) Locomotory Behavior (GO:0007626) Mating Behavior (GO:0007617) Memory (GO:0007613) Multicellular Organism Aging (GO:0010259) Neurotransmitter Biosynthetic Process (GO:0042136) Norepinephrine Biosynthetic Process (GO:0042421) Phthalate Metabolic Process (GO:0018963) Phytoalexin Metabolic Process (GO:0052314) Regulation Of Heart Contraction (GO:0008016) Response To Activity (GO:0014823) Response To Amphetamine (GO:0001975) Response To Corticosterone (GO:0051412) Response To Electrical Stimulus (GO:0051602) Response To Estradiol (GO:0032355) Response To Ethanol (GO:0045471) Response To Ether (GO:0045472) Response To Growth Factor (GO:0070848) Response To Herbicide (GO:0009635) Response To Hypoxia (GO:0001666) Response To Immobilization Stress (GO:0035902) Response To Insecticide (GO:0017085) Response To Isolation Stress (GO:0035900) Response To Light Stimulus (GO:0009416) Response To Lipopolysaccharide (GO:0032496) Response To Metal Ion (GO:0010038) Response To Nicotine (GO:0035094) Response To Nutrient Levels (GO:0031667) Response To Organic Cyclic Compound (GO:0014070) Response To Peptide Hormone (GO:0043434) Response To Pyrethroid (GO:0046684) Response To Salt Stress (GO:0009651) Response To Steroid Hormone (GO:0048545) Response To Water Deprivation (GO:0009414) Response To Xenobiotic Stimulus (GO:0009410) Response To Zinc Ion (GO:0010043) Sensory Perception Of Sound (GO:0007605) Social Behavior (GO:0035176) Sphingolipid Metabolic Process (GO:0006665) Synaptic Transmission, Dopaminergic (GO:0001963) Terpene Metabolic Process (GO:0042214) Visual Perception (GO:0007601)
Molecular Function	Amino Acid Binding (GO:0016597) Dopamine Binding (GO:0035240) Enzyme Binding (GO:0019899) Ferric Iron Binding (GO:0008199) Ferrous Iron Binding (GO:0008198) Identical Protein Binding (GO:0042802) Monooxygenase Activity (GO:0004497) Oxygen Binding (GO:0019825) Protein Domain Specific Binding (GO:0019904) Small Molecule Binding (GO:0036094) Tetrahydrobiopterin Binding (GO:0034617) Tyrosine 3-Monooxygenase Activity (GO:0004511)

Protein-Protein Interactions

Interactions with other proteins (3 interactors)

Partner (UniProt)		IntAct	Confidence score
P21708	Mitogen-activated protein kinase 3 (MAP kinase 3) (MAPK 3) (EC 2.7.11.24) (ERT2) (Extracellular signal-regulated kinase 1) (ERK-1) (Insulin-stimulated MAP2 kinase) (MAP kinase isoform p44) (p44-MAPK) (MNK1) (Microtubule-associated protein 2 kinase) (p44-ERK1)	EBI-7625716	0.35
P63102	14-3-3 protein zeta/delta (Mitochondrial import stimulation factor S1 subunit) (Protein kinase C inhibitor protein 1) (KCIP-1)	EBI-8595319	0.35
B5DFK6	Adaptor-related protein complex 3 subunit delta 1 (Adaptor-related protein complex 3, delta 1 subunit, isoform CRA_b) (Ap3d1 protein)	EBI-8097124	0.27

Cross-References

Database	Links
UNIPROT	P04177
PDB	1TOH 2MDA 2TOH
Pfam	PF00351 PF12549
PROSITE	PS00367 PS51410

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK