NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 - Rattus norvegicus - NucEnvDB

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 (Rattus norvegicus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
Accession Code	P10687
Gene	Plcb1
Organism	Rattus norvegicus \| Norway rat (Taxonomy: 10116)
Part of Reference Proteome?	Yes
Sequence (Length: 1216)
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKETELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGHLEQRMITVVYGPDLVNISHLNLVAFQEEVAKEW TNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPDVYRVFLNNLCPRPEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNE ILYPPLKQEQVQVLIEKYEPNSSLAKKGQMSVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKE VIEAIAECAFKTSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKKKLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDC KKSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFETSKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRL KPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPSLACLRIAAYEEGGKFIGHRILPVQAIRPGYHYICLRNER NQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKKEADPGETSSEAPSETRTTPAENGVNHTATLAPKPPSQAPHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTI EELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTELIKEHTTKYNEIQNDYLRRRAALEKSAKKDSKKKSEPSSPDHGSSAIEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQ KLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKLQMELEQEYQDKFKRLPLEILEFVQEAMK GKVSEDSNHGSAPPSLASDPAKVNLKSPSSEEVQGENAGREFDTPL

Subcellular Location

Description
Nucleus membrane {By SimilarityUniProtKB:Q9Z1B3}. Cytoplasm {Experimental EvidencePubMed:8454637}. Note=Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes. {By SimilarityUniProtKB:Q9Z1B3}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	By Similarity {ECO:0000250\|UniProtKB:Q9Z1B3}
Assigned Ontology terms

Cellular Component	Chromatin (GO:0000785) Cytoplasm (GO:0005737) Cytosol (GO:0005829) GABA-Ergic Synapse (GO:0098982) Glutamatergic Synapse (GO:0098978) Membrane (GO:0016020) Nuclear Membrane (GO:0031965) Nuclear Speck (GO:0016607) Nucleus (GO:0005634) Postsynapse (GO:0098794) Protein-Containing Complex (GO:0032991)

Biology & Function

Description
Catalyzes the hydrolysis of 1-phosphatidylinositol 4,5- bisphosphate into diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) and mediates intracellular signaling downstream of G protein- coupled receptors. Regulates the function of the endothelial barrier. {By SimilarityUniProtKB:Q9Z1B3}.
Assigned Ontology terms

Biological Process	Activation Of Meiosis Involved In Egg Activation (GO:0060466) Brain Development (GO:0007420) Cellular Response To Fluoride (GO:1902618) Cellular Response To Glyceraldehyde (GO:1905631) Cellular Response To Ionomycin (GO:1904637) Cellular Response To Vasopressin (GO:1904117) Cerebral Cortex Development (GO:0021987) Fat Cell Differentiation (GO:0045444) G Protein-Coupled Acetylcholine Receptor Signaling Pathway (GO:0007213) G2/M Transition Of Mitotic Cell Cycle (GO:0000086) Glutamate Receptor Signaling Pathway (GO:0007215) Inositol Trisphosphate Metabolic Process (GO:0032957) Insulin-Like Growth Factor Receptor Signaling Pathway (GO:0048009) Interleukin-1-Mediated Signaling Pathway (GO:0070498) Interleukin-12-Mediated Signaling Pathway (GO:0035722) Interleukin-15-Mediated Signaling Pathway (GO:0035723) Learning (GO:0007612) Memory (GO:0007613) Negative Regulation Of DNA-Templated Transcription (GO:0045892) Negative Regulation Of Monocyte Extravasation (GO:2000438) Phosphatidylinositol Catabolic Process (GO:0031161) Phosphatidylinositol Metabolic Process (GO:0046488) Phosphatidylinositol-Mediated Signaling (GO:0048015) Positive Regulation Of Acrosome Reaction (GO:2000344) Positive Regulation Of CD24 Production (GO:2000560) Positive Regulation Of Developmental Growth (GO:0048639) Positive Regulation Of DNA-Templated Transcription (GO:0045893) Positive Regulation Of Embryonic Development (GO:0040019) Positive Regulation Of G1/S Transition Of Mitotic Cell Cycle (GO:1900087) Positive Regulation Of Interleukin-12 Production (GO:0032735) Positive Regulation Of JNK Cascade (GO:0046330) Positive Regulation Of Myoblast Differentiation (GO:0045663) Postsynaptic Modulation Of Chemical Synaptic Transmission (GO:0099170) Regulation Of Establishment Of Endothelial Barrier (GO:1903140) Regulation Of Fertilization (GO:0080154) Regulation Of G Protein-Coupled Receptor Signaling Pathway (GO:0008277) Regulation Of Retrograde Trans-Synaptic Signaling By Endocanabinoid (GO:0099178) Response To Monosaccharide (GO:0034284) Response To Organonitrogen Compound (GO:0010243) Response To Peptide Hormone (GO:0043434)
Molecular Function	Calcium Ion Binding (GO:0005509) Calmodulin Binding (GO:0005516) Enzyme Binding (GO:0019899) GTPase Activator Activity (GO:0005096) Identical Protein Binding (GO:0042802) Lamin Binding (GO:0005521) Phosphatidylinositol Phospholipase C Activity (GO:0004435) Phosphatidylinositol-4,5-Bisphosphate Binding (GO:0005546)

Protein-Protein Interactions

Interactions with other proteins (6 interactors)

Partner (UniProt)		IntAct	Confidence score
Q8TEW0	Partitioning defective 3 homolog (PAR-3) (PARD-3) (Atypical PKC isotype-specific-interacting protein) (ASIP) (CTCL tumor antigen se2-5) (PAR3-alpha)	EBI-7551325	0.52
Q9NPB6	Partitioning defective 6 homolog alpha (PAR-6) (PAR-6 alpha) (PAR-6A) (PAR6C) (Tax interaction protein 40) (TIP-40)	EBI-7551375	0.52
Q96T51	RUN and FYVE domain-containing protein 1 (FYVE-finger protein EIP1) (La-binding protein 1) (Rab4-interacting protein) (Zinc finger FYVE domain-containing protein 12)	EBI-22240696	0.35
P54578	Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.4.19.12) (Deubiquitinating enzyme 14) (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14)	EBI-22241262	0.35
P17948	Vascular endothelial growth factor receptor 1 (VEGFR-1) (EC 2.7.10.1) (Fms-like tyrosine kinase 1) (FLT-1) (Tyrosine-protein kinase FRT) (Tyrosine-protein kinase receptor FLT) (FLT) (Vascular permeability factor receptor)	EBI-22251830	0.35
P51692	Signal transducer and activator of transcription 5B	EBI-22257101	0.35

Cross-References

Database	Links
UNIPROT	P10687
Pfam	PF06631 PF09279 PF17787 PF00388 PF00387 PF08703
PROSITE	PS50004 PS50007 PS50008

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK