Cyclin-dependent kinase 4 - Homo sapiens

Cyclin-dependent kinase 4 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Cyclin-dependent kinase 4
Accession Code	P11802
Gene	CDK4
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 303)
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCAT SRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFG LARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Structure Viewer (PDB: 5FWL)

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:18827403}. Nucleus {Experimental EvidencePubMed:18827403, Experimental EvidencePubMed:20399237, ECO:0000269\|PubMed:9106657}. Nucleus membrane {Experimental EvidencePubMed:18827403}. Note=Cytoplasmic when non-complexed. Forms a cyclin D-CDK4 complex in the cytoplasm as cells progress through G(1) phase. The complex accumulates on the nuclear membrane and enters the nucleus on transition from G(1) to S phase. Also present in nucleoli and heterochromatin lumps. Colocalizes with RB1 after release into the nucleus. {Experimental EvidencePubMed:18827403}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Bicellular Tight Junction (GO:0005923) Chromatin (GO:0000785) Cyclin D1-CDK4 Complex (GO:0097128) Cyclin D2-CDK4 Complex (GO:0097129) Cyclin D3-CDK4 Complex (GO:0097130) Cyclin-Dependent Protein Kinase Holoenzyme Complex (GO:0000307) Cytosol (GO:0005829) Mediator Complex (GO:0016592) Nuclear Membrane (GO:0031965) Nucleolus (GO:0005730) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Transcription Regulator Complex (GO:0005667)

Biology & Function

Description
Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complexes and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also phosphorylates SMAD3 in a cell-cycle-dependent manner and represses its transcriptional activity. Component of the ternary complex, cyclin D/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex. {Experimental EvidencePubMed:15241418, Experimental EvidencePubMed:18827403, Experimental EvidencePubMed:9003781}.
Assigned Ontology terms

Biological Process	Adipose Tissue Development (GO:0060612) Cell Division (GO:0051301) Cellular Response To Insulin Stimulus (GO:0032869) Cellular Response To Interleukin-4 (GO:0071353) Cellular Response To Ionomycin (GO:1904637) Cellular Response To Lipopolysaccharide (GO:0071222) Cellular Response To Phorbol 13-Acetate 12-Myristate (GO:1904628) G1/S Transition Of Mitotic Cell Cycle (GO:0000082) Positive Regulation Of Cell Population Proliferation (GO:0008284) Positive Regulation Of Fibroblast Proliferation (GO:0048146) Positive Regulation Of G2/M Transition Of Mitotic Cell Cycle (GO:0010971) Protein Phosphorylation (GO:0006468) Regulation Of Cell Cycle (GO:0051726) Regulation Of Gene Expression (GO:0010468) Regulation Of Insulin Receptor Signaling Pathway (GO:0046626) Regulation Of Lipid Biosynthetic Process (GO:0046890) Regulation Of Lipid Catabolic Process (GO:0050994) Regulation Of Multicellular Organism Growth (GO:0040014) Regulation Of Transcription Initiation By RNA Polymerase II (GO:0060260) Regulation Of Type B Pancreatic Cell Proliferation (GO:0061469) Response To Xenobiotic Stimulus (GO:0009410) Signal Transduction (GO:0007165)
Molecular Function	ATP Binding (GO:0005524) Cyclin Binding (GO:0030332) Cyclin-Dependent Protein Serine/Threonine Kinase Activity (GO:0004693) Cyclin-Dependent Protein Serine/Threonine Kinase Regulator Activity (GO:0016538) Protein Serine Kinase Activity (GO:0106310) RNA Polymerase II CTD Heptapeptide Repeat Kinase Activity (GO:0008353)

Disease associations

Description
Melanoma, cutaneous malignant 3 (CMM3) [MIM:609048]: A malignant neoplasm of melanocytes, arising de novo or from a pre- existing benign nevus, which occurs most often in the skin but may also involve other sites. {Experimental EvidencePubMed:7652577, Experimental EvidencePubMed:8528263, Experimental EvidencePubMed:9311594, Experimental EvidencePubMed:9425228}. Note=Disease susceptibility is associated with variants affecting the gene represented in this entry.
Database Associations
OMIM	123829 609048
DisGeNET	1019

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (13 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O75694	Nuclear pore complex protein Nup155	EBI-1065754	0.00
P01112	GTPase HRas, N-terminally processed	EBI-27045317	0.27
P07948	Tyrosine-protein kinase Lyn	EBI-1063758	0.00
P0DTD1	2'-O-methyltransferase nsp16	EBI-26495747	0.35
Q13261	Soluble interleukin-15 receptor subunit alpha	EBI-3906693	0.37
Q99828	Calcium and integrin-binding protein 1	EBI-3914485	0.37
Q92905	COP9 signalosome complex subunit 5	EBI-21325777	0.35
Q7L5N1	COP9 signalosome complex subunit 6	EBI-21328549	0.35
P53671	LIM domain kinase 2	EBI-10103591	0.35
Q8WUM0	Nuclear pore complex protein Nup133	EBI-11132267	0.35
P50613	Cyclin-dependent kinase 7	EBI-15560841	0.44
P24385	G1/S-specific cyclin-D1	EBI-375341	0.98
P30279	G1/S-specific cyclin-D2	EBI-768365	0.93
Interactions with other proteins (131 interactors)

Partner (UniProt)		IntAct	Confidence score
Q24158	Cyclin D	EBI-8620418	0.37
Q16543	Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) [Cleaved into: Hsp90 co-chaperone Cdc37, N-terminally processed]	EBI-295633	0.93
P42771	Cyclin-dependent kinase inhibitor 2A (Cyclin-dependent kinase 4 inhibitor A) (CDK4I) (Multiple tumor suppressor 1) (MTS-1) (p16-INK4a) (p16-INK4) (p16INK4A)	EBI-375269	0.96
P30281	G1/S-specific cyclin-D3	EBI-375326	0.98
P49736	DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2 homolog) (Nuclear protein BM28)	EBI-375329	0.44
P38936	Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)	EBI-375404	0.92
O00311	Cell division cycle 7-related protein kinase (CDC7-related kinase) (HsCdc7) (huCdc7) (EC 2.7.11.1)	EBI-375437	0.44
P49918	Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)	EBI-519276	0.40
P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	EBI-519297	0.93
Q8N720	Zinc finger protein 655 (Vav-interacting Krueppel-like protein)	EBI-625679	0.71
P42772	Cyclin-dependent kinase 4 inhibitor B (Multiple tumor suppressor 2) (MTS-2) (p14-INK4b) (p15-INK4b) (p15INK4B)	EBI-760282	0.97
P04632	Calpain small subunit 1 (CSS1) (Calcium-activated neutral proteinase small subunit) (CANP small subunit) (Calcium-dependent protease small subunit) (CDPS) (Calcium-dependent protease small subunit 1) (Calpain regulatory subunit)	EBI-728826	0.00
P46379	Large proline-rich protein BAG6 (BAG family molecular chaperone regulator 6) (BCL2-associated athanogene 6) (BAG-6) (HLA-B-associated transcript 3) (Protein G3) (Protein Scythe)	EBI-729744	0.00
Q15047	Histone-lysine N-methyltransferase SETDB1 (EC 2.1.1.366) (ERG-associated protein with SET domain) (ESET) (Histone H3-K9 methyltransferase 4) (H3-K9-HMTase 4) (Lysine N-methyltransferase 1E) (SET domain bifurcated 1)	EBI-7118776	0.55
Q9UGY1	Nucleolar protein 12	EBI-737135	0.00
P55273	Cyclin-dependent kinase 4 inhibitor D (p19-INK4d)	EBI-754729	0.96
Q9NP79	Vacuolar protein sorting-associated protein VTA1 homolog (Dopamine-responsive gene 1 protein) (DRG-1) (LYST-interacting protein 5) (LIP5) (SKD1-binding protein 1) (SBP1)	EBI-758428	0.37
Q1EHW4	Histone deacetylase complex subunit SAP25 (25 kDa Sin3-associated polypeptide) (Sin3 corepressor complex subunit SAP25) (mSin3A-binding protein)	EBI-922367	0.35
Q9UJU6	Drebrin-like protein (Cervical SH3P7) (Cervical mucin-associated protein) (Drebrin-F) (HPK1-interacting protein of 55 kDa) (HIP-55) (SH3 domain-containing protein 7)	EBI-1063375	0.00
Q9NS64	Protein reprimo	EBI-1063663	0.00
Q8IZT6	Abnormal spindle-like microcephaly-associated protein (Abnormal spindle protein homolog) (Asp homolog)	EBI-11132267	0.56
P23508	Colorectal mutant cancer protein (Protein MCC)	EBI-1065583	0.00
Q12996	Cleavage stimulation factor subunit 3 (CF-1 77 kDa subunit) (Cleavage stimulation factor 77 kDa subunit) (CSTF 77 kDa subunit) (CstF-77)	EBI-1066306	0.00
P42773	Cyclin-dependent kinase 4 inhibitor C (Cyclin-dependent kinase 6 inhibitor) (p18-INK4c) (p18-INK6)	EBI-3906668	0.97
Q04323	UBX domain-containing protein 1 (SAPK substrate protein 1) (UBA/UBX 33.3 kDa protein)	EBI-1068290	0.00
P57678	Gem-associated protein 4 (Gemin-4) (Component of gems 4) (p97)	EBI-1068996	0.00
Q96T76	MMS19 nucleotide excision repair protein homolog (hMMS19) (MET18 homolog) (MMS19-like protein)	EBI-1069744	0.00
Q9UQE7	Structural maintenance of chromosomes protein 3 (SMC protein 3) (SMC-3) (Basement membrane-associated chondroitin proteoglycan) (Bamacan) (Chondroitin sulfate proteoglycan 6) (Chromosome-associated polypeptide) (hCAP)	EBI-1071705	0.00
P35606	Coatomer subunit beta' (Beta'-coat protein) (Beta'-COP) (p102)	EBI-1072884	0.00
Q14683	Structural maintenance of chromosomes protein 1A (SMC protein 1A) (SMC-1-alpha) (SMC-1A) (Sb1.8)	EBI-1073208	0.00
Q9UDX5	Mitochondrial fission process protein 1 (Mitochondrial 18 kDa protein) (MTP18)	EBI-1074355	0.00
Q9P1U1	Actin-related protein 3B (ARP3-beta) (Actin-like protein 3B) (Actin-related protein ARP4)	EBI-1075412	0.00
P62136	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16)	EBI-1206902	0.00
P36873	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit)	EBI-1207334	0.00
P30154	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (PP2A subunit A isoform PR65-beta) (PP2A subunit A isoform R1-beta)	EBI-1266474	0.35
P30153	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (Medium tumor antigen-associated 61 kDa protein) (PP2A subunit A isoform PR65-alpha) (PP2A subunit A isoform R1-alpha)	EBI-1266485	0.35
P32121	Beta-arrestin-2 (Arrestin beta-2) (Non-visual arrestin-3)	EBI-1642843	0.35
Q9BQA1	Methylosome protein 50 (MEP-50) (Androgen receptor cofactor p44) (WD repeat-containing protein 77) (p44/Mep50)	EBI-2940933	0.35
Q9H0R8	Gamma-aminobutyric acid receptor-associated protein-like 1 (Early estrogen-regulated protein) (GABA(A) receptor-associated protein-like 1) (Glandular epithelial cell protein 1) (GEC-1)	EBI-3048562	0.35
P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	EBI-3906703	0.59
Q99956	Dual specificity protein phosphatase 9 (EC 3.1.3.16) (EC 3.1.3.48) (Mitogen-activated protein kinase phosphatase 4) (MAP kinase phosphatase 4) (MKP-4)	EBI-3906683	0.37
P63208	S-phase kinase-associated protein 1 (Cyclin-A/CDK2-associated protein p19) (p19A) (Organ of Corti protein 2) (OCP-2) (Organ of Corti protein II) (OCP-II) (RNA polymerase II elongation factor-like protein) (SIII) (Transcription elongation factor B polypeptide 1-like) (p19skp1)	EBI-3906713	0.37
Q15555	Microtubule-associated protein RP/EB family member 2 (APC-binding protein EB2) (End-binding protein 2) (EB2)	EBI-3914495	0.37
P52209	6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)	EBI-3927622	0.37
P20073	Annexin A7 (Annexin VII) (Annexin-7) (Synexin)	EBI-7096705	0.37
P51693	Amyloid beta precursor like protein 1 (Amyloid beta (A4) precursor-like protein 1) (Amyloid-like protein 1) (APLP) (APLP-1) [Cleaved into: C30]	EBI-7117963	0.37
P06576	ATP synthase subunit beta, mitochondrial (EC 7.1.2.2) (ATP synthase F1 subunit beta)	EBI-7118041	0.37
O95865	N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 (DDAH-2) (Dimethylarginine dimethylaminohydrolase 2) (EC 3.5.3.18) (DDAHII) (Dimethylargininase-2) (Protein G6a) (S-phase protein)	EBI-7118309	0.37
Q12766	HMG domain-containing protein 3 (HMG box-containing protein 3) (Protein SMF)	EBI-7118436	0.37
Q9Y383	Putative RNA-binding protein Luc7-like 2	EBI-7118499	0.37
P14618	Pyruvate kinase PKM (EC 2.7.1.40) (Cytosolic thyroid hormone-binding protein) (CTHBP) (Opa-interacting protein 3) (OIP-3) (Pyruvate kinase 2/3) (Pyruvate kinase muscle isozyme) (Threonine-protein kinase PKM2) (EC 2.7.11.1) (Thyroid hormone-binding protein 1) (THBP1) (Tumor M2-PK) (Tyrosine-protein kinase PKM2) (EC 2.7.10.2) (p58)	EBI-7118577	0.37
P47897	Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS)	EBI-7118684	0.37
Q8IZ69	tRNA (uracil-5-)-methyltransferase homolog A (EC 2.1.1.35) (mRNA (uracil-5-)-methyltransferase TRMT2A) (EC 2.1.1.-)	EBI-7118859	0.37
Q05516	Zinc finger and BTB domain-containing protein 16 (Promyelocytic leukemia zinc finger protein) (Zinc finger protein 145) (Zinc finger protein PLZF)	EBI-7118939	0.37
Q15038	DAZ-associated protein 2 (Deleted in azoospermia-associated protein 2) (Proline-rich transcript in brain protein)	EBI-7139218	0.37
P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	EBI-7391065	0.37
P04183	Thymidine kinase, cytosolic (EC 2.7.1.21)	EBI-7396108	0.37
Q8IZC7	Zinc finger protein 101 (Zinc finger protein HZF12)	EBI-5283871	0.44
Q9H165	B-cell lymphoma/leukemia 11A (BCL-11A) (B-cell CLL/lymphoma 11A) (COUP-TF-interacting protein 1) (Ecotropic viral integration site 9 protein homolog) (EVI-9) (Zinc finger protein 856)	EBI-5283535	0.44
Q08050	Forkhead box protein M1 (Forkhead-related protein FKHL16) (Hepatocyte nuclear factor 3 forkhead homolog 11) (HFH-11) (HNF-3/fork-head homolog 11) (M-phase phosphoprotein 2) (MPM-2 reactive phosphoprotein 2) (Transcription factor Trident) (Winged-helix factor from INS-1 cells)	EBI-5283631	0.44
P32243	Homeobox protein OTX2 (Orthodenticle homolog 2)	EBI-5278204	0.44
P28698	Myeloid zinc finger 1 (MZF-1) (Zinc finger and SCAN domain-containing protein 6) (Zinc finger protein 42)	EBI-5283775	0.44
O60902	Short stature homeobox protein 2 (Homeobox protein Og12X) (Paired-related homeobox protein SHOT)	EBI-5282940	0.44
Q9P2Y4	Zinc finger protein 219	EBI-5282927	0.44
Q99741	Cell division control protein 6 homolog (CDC6-related protein) (Cdc18-related protein) (HsCdc18) (p62(cdc6)) (HsCDC6)	EBI-5283967	0.44
P28749	Retinoblastoma-like protein 1 (107 kDa retinoblastoma-associated protein) (p107) (pRb1)	EBI-5278658	0.44
Q14493	Histone RNA hairpin-binding protein (Histone stem-loop-binding protein)	EBI-5284015	0.44
Q9H4L4	Sentrin-specific protease 3 (EC 3.4.22.-) (SUMO-1-specific protease 3) (Sentrin/SUMO-specific protease SENP3)	EBI-5283823	0.44
Q08999	Retinoblastoma-like protein 2 (130 kDa retinoblastoma-associated protein) (p130) (Retinoblastoma-related protein 2) (RBR-2) (pRb2)	EBI-5283583	0.44
Q9H4Z2	Zinc finger protein 335 (NRC-interacting factor 1) (NIF-1)	EBI-5284063	0.44
Q6UB98	Ankyrin repeat domain-containing protein 12 (Ankyrin repeat-containing cofactor 2) (GAC-1 protein)	EBI-5283727	0.44
Q9C0J8	pre-mRNA 3' end processing protein WDR33 (WD repeat-containing protein 33) (WD repeat-containing protein of 146 kDa)	EBI-5282970	0.44
P08151	Zinc finger protein GLI1 (Glioma-associated oncogene) (Oncogene GLI)	EBI-5282953	0.44
Q96PU4	E3 ubiquitin-protein ligase UHRF2 (EC 2.3.2.27) (Np95/ICBP90-like RING finger protein) (Np95-like RING finger protein) (Nuclear protein 97) (Nuclear zinc finger protein Np97) (RING finger protein 107) (RING-type E3 ubiquitin transferase UHRF2) (Ubiquitin-like PHD and RING finger domain-containing protein 2) (Ubiquitin-like-containing PHD and RING finger domains protein 2)	EBI-6051398	0.40
Q02556	Interferon regulatory factor 8 (IRF-8) (Interferon consensus sequence-binding protein) (H-ICSBP) (ICSBP)	EBI-6115692	0.35
P08238	Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84)	EBI-6255377	0.78
P07900	Heat shock protein HSP 90-alpha (EC 3.6.4.10) (Heat shock 86 kDa) (HSP 86) (HSP86) (Lipopolysaccharide-associated protein 2) (LAP-2) (LPS-associated protein 2) (Renal carcinoma antigen NY-REN-38)	EBI-6255377	0.53
Q00534	Cyclin-dependent kinase 6 (EC 2.7.11.22) (Cell division protein kinase 6) (Serine/threonine-protein kinase PLSTIRE)	EBI-6255377	0.35
Q12931	Heat shock protein 75 kDa, mitochondrial (HSP 75) (TNFR-associated protein 1) (Tumor necrosis factor type 1 receptor-associated protein) (TRAP-1)	EBI-6255377	0.35
Q14004	Cyclin-dependent kinase 13 (EC 2.7.11.22) (EC 2.7.11.23) (CDC2-related protein kinase 5) (Cell division cycle 2-like protein kinase 5) (Cell division protein kinase 13) (hCDK13) (Cholinesterase-related cell division controller)	EBI-6380178	0.53
Q13616	Cullin-1 (CUL-1)	EBI-21323857	0.35
Q13620	Cullin-4B (CUL-4B)	EBI-21327757	0.35
Q13618	Cullin-3 (CUL-3)	EBI-21329068	0.35
P84022	Mothers against decapentaplegic homolog 3 (MAD homolog 3) (Mad3) (Mothers against DPP homolog 3) (hMAD-3) (JV15-2) (SMAD family member 3) (SMAD 3) (Smad3) (hSMAD3)	EBI-6593176	0.27
Q77Q36	viral cyclin homolog (v-cyclin)	EBI-9082540	0.40
Q13451	Peptidyl-prolyl cis-trans isomerase FKBP5 (PPIase FKBP5) (EC 5.2.1.8) (51 kDa FK506-binding protein) (51 kDa FKBP) (FKBP-51) (54 kDa progesterone receptor-associated immunophilin) (Androgen-regulated protein 6) (FF1 antigen) (FK506-binding protein 5) (FKBP-5) (FKBP54) (p54) (HSP90-binding immunophilin) (Rotamase)	EBI-9393873	0.64
Q9UJC3	Protein Hook homolog 1 (h-hook1) (hHK1)	EBI-10197685	0.86
P03129	Protein E7	EBI-11721568	0.35
Q9BX66	Sorbin and SH3 domain-containing protein 1 (Ponsin) (SH3 domain protein 5) (SH3P12) (c-Cbl-associated protein) (CAP)	EBI-11132267	0.35
P53814	Smoothelin	EBI-11132267	0.35
Q9P2E3	NFX1-type zinc finger-containing protein 1	EBI-11132267	0.35
Q6PJT7	Zinc finger CCCH domain-containing protein 14 (Mammalian suppressor of tau pathology-2) (MSUT-2) (Renal carcinoma antigen NY-REN-37)	EBI-11132267	0.35
Q9H061	Transmembrane protein 126A	EBI-11132267	0.35
P46940	Ras GTPase-activating-like protein IQGAP1 (p195)	EBI-11132927	0.35
Q66GS9	Centrosomal protein of 135 kDa (Cep135) (Centrosomal protein 4)	EBI-11386281	0.27
Q8N448	Ligand of Numb protein X 2 (Numb-binding protein 2) (PDZ domain-containing RING finger protein 1)	EBI-11766518	0.49
Q16254	Transcription factor E2F4 (E2F-4)	EBI-12449950	0.53
P49815	Tuberin (Tuberous sclerosis 2 protein)	EBI-11687060	0.40
Q9UKT9	Zinc finger protein Aiolos (Ikaros family zinc finger protein 3)	EBI-24394070	0.56
Q0VD86	Protein INCA1 (Inhibitor of CDK interacting with cyclin A1)	EBI-24622275	0.56
Q9ULD0	2-oxoglutarate dehydrogenase-like, mitochondrial (EC 1.2.4.2) (2-oxoglutarate dehydrogenase complex component E1-like) (OGDC-E1-like) (Alpha-ketoglutarate dehydrogenase-like)	EBI-24764997	0.56
Q8WXX5	DnaJ homolog subfamily C member 9 (HDJC9) (DnaJ protein SB73)	EBI-11925475	0.00
Q8IVT5	Kinase suppressor of Ras 1 (EC 2.7.11.1)	EBI-14035152	0.35
P04004	Vitronectin (VN) (S-protein) (Serum-spreading factor) (V75) [Cleaved into: Vitronectin V65 subunit; Vitronectin V10 subunit; Somatomedin-B]	EBI-21709311	0.35
Q9UKA8	Calcipressin-3 (Down syndrome candidate region 1-like protein 2) (Myocyte-enriched calcineurin-interacting protein 3) (MCIP3) (Regulator of calcineurin 3)	EBI-21786597	0.35
Q58FG0	Putative heat shock protein HSP 90-alpha A5 (Heat shock protein 90-alpha E) (Heat shock protein 90Ae)	EBI-21835664	0.35
Q5TC84	Opioid growth factor receptor-like protein 1	EBI-21835664	0.35
Q58FF7	Putative heat shock protein HSP 90-beta-3 (Heat shock protein 90-beta c) (Heat shock protein 90Bc)	EBI-21835664	0.35
Q58FF6	Putative heat shock protein HSP 90-beta 4	EBI-21835664	0.35
P55789	FAD-linked sulfhydryl oxidase ALR (EC 1.8.3.2) (Augmenter of liver regeneration) (hERV1) (Hepatopoietin)	EBI-21835664	0.35
P52333	Tyrosine-protein kinase JAK3 (EC 2.7.10.2) (Janus kinase 3) (JAK-3) (Leukocyte janus kinase) (L-JAK)	EBI-21835664	0.35
P08236	Beta-glucuronidase (EC 3.2.1.31) (Beta-G1)	EBI-21835664	0.35
Q9NZT2	Opioid growth factor receptor (OGFr) (Protein 7-60) (Zeta-type opioid receptor)	EBI-21848776	0.40
P46414	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	EBI-15763467	0.40
Q92830	Histone acetyltransferase KAT2A (EC 2.3.1.48) (General control of amino acid synthesis protein 5-like 2) (Histone acetyltransferase GCN5) (hGCN5) (Histone glutaryltransferase KAT2A) (EC 2.3.1.-) (Histone succinyltransferase KAT2A) (EC 2.3.1.-) (Lysine acetyltransferase 2A) (STAF97)	EBI-16107564	0.40
Q9JHD2	Histone acetyltransferase KAT2A (EC 2.3.1.48) (General control of amino acid synthesis protein 5-like 2) (Histone acetyltransferase GCN5) (MmGCN5) (Histone glutaryltransferase KAT2A) (EC 2.3.1.-) (Histone succinyltransferase KAT2A) (EC 2.3.1.-) (Lysine acetyltransferase 2A)	EBI-16107581	0.40
Q9Y6K9	NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier)	EBI-20737021	0.35
Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin)	EBI-21360986	0.35
Q9UH17	DNA dC->dU-editing enzyme APOBEC-3B (A3B) (EC 3.5.4.38) (Phorbolin-1-related protein) (Phorbolin-2/3)	EBI-25296426	0.64
P82930	28S ribosomal protein S34, mitochondrial (MRP-S34) (S34mt) (Mitochondrial small ribosomal subunit protein mS34)	EBI-25477405	0.35
P53007	Tricarboxylate transport protein, mitochondrial (Citrate transport protein) (CTP) (Mitochondrial citrate carrier) (CIC) (Solute carrier family 25 member 1) (Tricarboxylate carrier protein)	EBI-25477405	0.35
P43307	Translocon-associated protein subunit alpha (TRAP-alpha) (Signal sequence receptor subunit alpha) (SSR-alpha)	EBI-25477405	0.35
P28482	Mitogen-activated protein kinase 1 (MAP kinase 1) (MAPK 1) (EC 2.7.11.24) (ERT1) (Extracellular signal-regulated kinase 2) (ERK-2) (MAP kinase isoform p42) (p42-MAPK) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2)	EBI-25477405	0.35
P54819	Adenylate kinase 2, mitochondrial (AK 2) (EC 2.7.4.3) (ATP-AMP transphosphorylase 2) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) [Cleaved into: Adenylate kinase 2, mitochondrial, N-terminally processed]	EBI-25477405	0.35
Q8TB24	Ras and Rab interactor 3 (Ras interaction/interference protein 3)	EBI-26518569	0.35
Q9H9E1	Ankyrin repeat family A protein 2 (RFXANK-like protein 2)	EBI-26656693	0.35
P01116	GTPase KRas (EC 3.6.5.2) (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed]	EBI-27041844	0.27
P01111	GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras)	EBI-27042293	0.27
P09936	Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCH-L1) (EC 3.4.19.12) (Neuron cytoplasmic protein 9.5) (PGP 9.5) (PGP9.5) (Ubiquitin thioesterase L1)	EBI-27121923	0.59
P00441	Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) (Superoxide dismutase 1) (hSod1)	EBI-28996885	0.40
Q13619	Cullin-4A (CUL-4A)	EBI-30863570	0.35

Cross-References

Database	Links
UNIPROT	P11802 B2R9A0 B4DNF9 O00576 Q6FG61
PDB	2W96 2W99 2W9F 2W9Z 3G33 5FWK 5FWL 5FWM 5FWP 6P8E 6P8F 6P8G 6P8H
Pfam	PF00069
PROSITE	PS00107 PS50011 PS00108
OMIM	123829 609048
DisGeNET	1019

Cyclin-dependent kinase 4 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 5FWL)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Disease associations

Description

Database Associations

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (13 interactors)

Interactions with other proteins (131 interactors)

Cross-References

Database

Links

Description

Description