Protein Information |
|
|---|---|
| Protein Name | Cyclin-dependent kinase 4 |
| Accession Code | P11802 |
| Gene | CDK4 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 303) | |
|
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCAT SRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFG LARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
|
Structure Viewer (PDB: 6P8H) |
|---|
Description |
||
|---|---|---|
| Cytoplasm {Experimental EvidencePubMed:18827403}. Nucleus {Experimental EvidencePubMed:18827403, Experimental EvidencePubMed:20399237, ECO:0000269|PubMed:9106657}. Nucleus membrane {Experimental EvidencePubMed:18827403}. Note=Cytoplasmic when non-complexed. Forms a cyclin D-CDK4 complex in the cytoplasm as cells progress through G(1) phase. The complex accumulates on the nuclear membrane and enters the nucleus on transition from G(1) to S phase. Also present in nucleoli and heterochromatin lumps. Colocalizes with RB1 after release into the nucleus. {Experimental EvidencePubMed:18827403}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Nuclear Envelope | SL-0178 | The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space. |
| Nuclear Membrane | SL-0182 | The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Bicellular Tight Junction (GO:0005923) Chromatin (GO:0000785) Cyclin D1-CDK4 Complex (GO:0097128) Cyclin D2-CDK4 Complex (GO:0097129) Cyclin D3-CDK4 Complex (GO:0097130) Cyclin-Dependent Protein Kinase Holoenzyme Complex (GO:0000307) Cytosol (GO:0005829) Mediator Complex (GO:0016592) Nuclear Membrane (GO:0031965) Nucleolus (GO:0005730) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Transcription Regulator Complex (GO:0005667) |
|
Description |
|
|---|---|
| Melanoma, cutaneous malignant 3 (CMM3) [MIM:609048]: A malignant neoplasm of melanocytes, arising de novo or from a pre- existing benign nevus, which occurs most often in the skin but may also involve other sites. {Experimental EvidencePubMed:7652577, Experimental EvidencePubMed:8528263, Experimental EvidencePubMed:9311594, Experimental EvidencePubMed:9425228}. Note=Disease susceptibility is associated with variants affecting the gene represented in this entry. | Database Associations |
| OMIM | 123829 609048 |
| DisGeNET | 1019 |
Interactions with Nuclear Envelope proteins (13 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| O75694 | Nuclear pore complex protein Nup155 | EBI-1065754 | 0.00 |
| P01112 | GTPase HRas, N-terminally processed | EBI-27045317 | 0.27 |
| P07948 | Tyrosine-protein kinase Lyn | EBI-1063758 | 0.00 |
| P0DTD1 | 2'-O-methyltransferase nsp16 | EBI-26495747 | 0.35 |
| Q13261 | Soluble interleukin-15 receptor subunit alpha | EBI-3906693 | 0.37 |
| Q99828 | Calcium and integrin-binding protein 1 | EBI-3914485 | 0.37 |
| Q92905 | COP9 signalosome complex subunit 5 | EBI-21325777 | 0.35 |
| Q7L5N1 | COP9 signalosome complex subunit 6 | EBI-21328549 | 0.35 |
| P53671 | LIM domain kinase 2 | EBI-10103591 | 0.35 |
| Q8WUM0 | Nuclear pore complex protein Nup133 | EBI-11132267 | 0.35 |
| P50613 | Cyclin-dependent kinase 7 | EBI-15560841 | 0.44 |
| P24385 | G1/S-specific cyclin-D1 | EBI-375341 | 0.98 |
| P30279 | G1/S-specific cyclin-D2 | EBI-768365 | 0.93 | Interactions with other proteins (131 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q24158 | Cyclin D | EBI-8620418 | 0.37 |
| Q16543 | Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) [Cleaved into: Hsp90 co-chaperone Cdc37, N-terminally processed] | EBI-295633 | 0.93 |
| P42771 | Cyclin-dependent kinase inhibitor 2A (Cyclin-dependent kinase 4 inhibitor A) (CDK4I) (Multiple tumor suppressor 1) (MTS-1) (p16-INK4a) (p16-INK4) (p16INK4A) | EBI-375269 | 0.96 |
| P30281 | G1/S-specific cyclin-D3 | EBI-375326 | 0.98 |
| P49736 | DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2 homolog) (Nuclear protein BM28) | EBI-375329 | 0.44 |
| P38936 | Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) | EBI-375404 | 0.92 |
| O00311 | Cell division cycle 7-related protein kinase (CDC7-related kinase) (HsCdc7) (huCdc7) (EC 2.7.11.1) | EBI-375437 | 0.44 |
| P49918 | Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2) | EBI-519276 | 0.40 |
| P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | EBI-519297 | 0.93 |
| Q8N720 | Zinc finger protein 655 (Vav-interacting Krueppel-like protein) | EBI-625679 | 0.71 |
| P42772 | Cyclin-dependent kinase 4 inhibitor B (Multiple tumor suppressor 2) (MTS-2) (p14-INK4b) (p15-INK4b) (p15INK4B) | EBI-760282 | 0.97 |
| P04632 | Calpain small subunit 1 (CSS1) (Calcium-activated neutral proteinase small subunit) (CANP small subunit) (Calcium-dependent protease small subunit) (CDPS) (Calcium-dependent protease small subunit 1) (Calpain regulatory subunit) | EBI-728826 | 0.00 |
| P46379 | Large proline-rich protein BAG6 (BAG family molecular chaperone regulator 6) (BCL2-associated athanogene 6) (BAG-6) (HLA-B-associated transcript 3) (Protein G3) (Protein Scythe) | EBI-729744 | 0.00 |
| Q15047 | Histone-lysine N-methyltransferase SETDB1 (EC 2.1.1.366) (ERG-associated protein with SET domain) (ESET) (Histone H3-K9 methyltransferase 4) (H3-K9-HMTase 4) (Lysine N-methyltransferase 1E) (SET domain bifurcated 1) | EBI-7118776 | 0.55 |
| Q9UGY1 | Nucleolar protein 12 | EBI-737135 | 0.00 |
| P55273 | Cyclin-dependent kinase 4 inhibitor D (p19-INK4d) | EBI-754729 | 0.96 |
| Q9NP79 | Vacuolar protein sorting-associated protein VTA1 homolog (Dopamine-responsive gene 1 protein) (DRG-1) (LYST-interacting protein 5) (LIP5) (SKD1-binding protein 1) (SBP1) | EBI-758428 | 0.37 |
| Q1EHW4 | Histone deacetylase complex subunit SAP25 (25 kDa Sin3-associated polypeptide) (Sin3 corepressor complex subunit SAP25) (mSin3A-binding protein) | EBI-922367 | 0.35 |
| Q9UJU6 | Drebrin-like protein (Cervical SH3P7) (Cervical mucin-associated protein) (Drebrin-F) (HPK1-interacting protein of 55 kDa) (HIP-55) (SH3 domain-containing protein 7) | EBI-1063375 | 0.00 |
| Q9NS64 | Protein reprimo | EBI-1063663 | 0.00 |
| Q8IZT6 | Abnormal spindle-like microcephaly-associated protein (Abnormal spindle protein homolog) (Asp homolog) | EBI-11132267 | 0.56 |
| P23508 | Colorectal mutant cancer protein (Protein MCC) | EBI-1065583 | 0.00 |
| Q12996 | Cleavage stimulation factor subunit 3 (CF-1 77 kDa subunit) (Cleavage stimulation factor 77 kDa subunit) (CSTF 77 kDa subunit) (CstF-77) | EBI-1066306 | 0.00 |
| P42773 | Cyclin-dependent kinase 4 inhibitor C (Cyclin-dependent kinase 6 inhibitor) (p18-INK4c) (p18-INK6) | EBI-3906668 | 0.97 |
| Q04323 | UBX domain-containing protein 1 (SAPK substrate protein 1) (UBA/UBX 33.3 kDa protein) | EBI-1068290 | 0.00 |
| P57678 | Gem-associated protein 4 (Gemin-4) (Component of gems 4) (p97) | EBI-1068996 | 0.00 |
| Q96T76 | MMS19 nucleotide excision repair protein homolog (hMMS19) (MET18 homolog) (MMS19-like protein) | EBI-1069744 | 0.00 |
| Q9UQE7 | Structural maintenance of chromosomes protein 3 (SMC protein 3) (SMC-3) (Basement membrane-associated chondroitin proteoglycan) (Bamacan) (Chondroitin sulfate proteoglycan 6) (Chromosome-associated polypeptide) (hCAP) | EBI-1071705 | 0.00 |
| P35606 | Coatomer subunit beta' (Beta'-coat protein) (Beta'-COP) (p102) | EBI-1072884 | 0.00 |
| Q14683 | Structural maintenance of chromosomes protein 1A (SMC protein 1A) (SMC-1-alpha) (SMC-1A) (Sb1.8) | EBI-1073208 | 0.00 |
| Q9UDX5 | Mitochondrial fission process protein 1 (Mitochondrial 18 kDa protein) (MTP18) | EBI-1074355 | 0.00 |
| Q9P1U1 | Actin-related protein 3B (ARP3-beta) (Actin-like protein 3B) (Actin-related protein ARP4) | EBI-1075412 | 0.00 |
| P62136 | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16) | EBI-1206902 | 0.00 |
| P36873 | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit) | EBI-1207334 | 0.00 |
| P30154 | Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (PP2A subunit A isoform PR65-beta) (PP2A subunit A isoform R1-beta) | EBI-1266474 | 0.35 |
| P30153 | Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (Medium tumor antigen-associated 61 kDa protein) (PP2A subunit A isoform PR65-alpha) (PP2A subunit A isoform R1-alpha) | EBI-1266485 | 0.35 |
| P32121 | Beta-arrestin-2 (Arrestin beta-2) (Non-visual arrestin-3) | EBI-1642843 | 0.35 |
| Q9BQA1 | Methylosome protein 50 (MEP-50) (Androgen receptor cofactor p44) (WD repeat-containing protein 77) (p44/Mep50) | EBI-2940933 | 0.35 |
| Q9H0R8 | Gamma-aminobutyric acid receptor-associated protein-like 1 (Early estrogen-regulated protein) (GABA(A) receptor-associated protein-like 1) (Glandular epithelial cell protein 1) (GEC-1) | EBI-3048562 | 0.35 |
| P01106 | Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) | EBI-3906703 | 0.59 |
| Q99956 | Dual specificity protein phosphatase 9 (EC 3.1.3.16) (EC 3.1.3.48) (Mitogen-activated protein kinase phosphatase 4) (MAP kinase phosphatase 4) (MKP-4) | EBI-3906683 | 0.37 |
| P63208 | S-phase kinase-associated protein 1 (Cyclin-A/CDK2-associated protein p19) (p19A) (Organ of Corti protein 2) (OCP-2) (Organ of Corti protein II) (OCP-II) (RNA polymerase II elongation factor-like protein) (SIII) (Transcription elongation factor B polypeptide 1-like) (p19skp1) | EBI-3906713 | 0.37 |
| Q15555 | Microtubule-associated protein RP/EB family member 2 (APC-binding protein EB2) (End-binding protein 2) (EB2) | EBI-3914495 | 0.37 |
| P52209 | 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) | EBI-3927622 | 0.37 |
| P20073 | Annexin A7 (Annexin VII) (Annexin-7) (Synexin) | EBI-7096705 | 0.37 |
| P51693 | Amyloid beta precursor like protein 1 (Amyloid beta (A4) precursor-like protein 1) (Amyloid-like protein 1) (APLP) (APLP-1) [Cleaved into: C30] | EBI-7117963 | 0.37 |
| P06576 | ATP synthase subunit beta, mitochondrial (EC 7.1.2.2) (ATP synthase F1 subunit beta) | EBI-7118041 | 0.37 |
| O95865 | N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 (DDAH-2) (Dimethylarginine dimethylaminohydrolase 2) (EC 3.5.3.18) (DDAHII) (Dimethylargininase-2) (Protein G6a) (S-phase protein) | EBI-7118309 | 0.37 |
| Q12766 | HMG domain-containing protein 3 (HMG box-containing protein 3) (Protein SMF) | EBI-7118436 | 0.37 |
| Q9Y383 | Putative RNA-binding protein Luc7-like 2 | EBI-7118499 | 0.37 |
| P14618 | Pyruvate kinase PKM (EC 2.7.1.40) (Cytosolic thyroid hormone-binding protein) (CTHBP) (Opa-interacting protein 3) (OIP-3) (Pyruvate kinase 2/3) (Pyruvate kinase muscle isozyme) (Threonine-protein kinase PKM2) (EC 2.7.11.1) (Thyroid hormone-binding protein 1) (THBP1) (Tumor M2-PK) (Tyrosine-protein kinase PKM2) (EC 2.7.10.2) (p58) | EBI-7118577 | 0.37 |
| P47897 | Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) | EBI-7118684 | 0.37 |
| Q8IZ69 | tRNA (uracil-5-)-methyltransferase homolog A (EC 2.1.1.35) (mRNA (uracil-5-)-methyltransferase TRMT2A) (EC 2.1.1.-) | EBI-7118859 | 0.37 |
| Q05516 | Zinc finger and BTB domain-containing protein 16 (Promyelocytic leukemia zinc finger protein) (Zinc finger protein 145) (Zinc finger protein PLZF) | EBI-7118939 | 0.37 |
| Q15038 | DAZ-associated protein 2 (Deleted in azoospermia-associated protein 2) (Proline-rich transcript in brain protein) | EBI-7139218 | 0.37 |
| P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | EBI-7391065 | 0.37 |
| P04183 | Thymidine kinase, cytosolic (EC 2.7.1.21) | EBI-7396108 | 0.37 |
| Q8IZC7 | Zinc finger protein 101 (Zinc finger protein HZF12) | EBI-5283871 | 0.44 |
| Q9H165 | B-cell lymphoma/leukemia 11A (BCL-11A) (B-cell CLL/lymphoma 11A) (COUP-TF-interacting protein 1) (Ecotropic viral integration site 9 protein homolog) (EVI-9) (Zinc finger protein 856) | EBI-5283535 | 0.44 |
| Q08050 | Forkhead box protein M1 (Forkhead-related protein FKHL16) (Hepatocyte nuclear factor 3 forkhead homolog 11) (HFH-11) (HNF-3/fork-head homolog 11) (M-phase phosphoprotein 2) (MPM-2 reactive phosphoprotein 2) (Transcription factor Trident) (Winged-helix factor from INS-1 cells) | EBI-5283631 | 0.44 |
| P32243 | Homeobox protein OTX2 (Orthodenticle homolog 2) | EBI-5278204 | 0.44 |
| P28698 | Myeloid zinc finger 1 (MZF-1) (Zinc finger and SCAN domain-containing protein 6) (Zinc finger protein 42) | EBI-5283775 | 0.44 |
| O60902 | Short stature homeobox protein 2 (Homeobox protein Og12X) (Paired-related homeobox protein SHOT) | EBI-5282940 | 0.44 |
| Q9P2Y4 | Zinc finger protein 219 | EBI-5282927 | 0.44 |
| Q99741 | Cell division control protein 6 homolog (CDC6-related protein) (Cdc18-related protein) (HsCdc18) (p62(cdc6)) (HsCDC6) | EBI-5283967 | 0.44 |
| P28749 | Retinoblastoma-like protein 1 (107 kDa retinoblastoma-associated protein) (p107) (pRb1) | EBI-5278658 | 0.44 |
| Q14493 | Histone RNA hairpin-binding protein (Histone stem-loop-binding protein) | EBI-5284015 | 0.44 |
| Q9H4L4 | Sentrin-specific protease 3 (EC 3.4.22.-) (SUMO-1-specific protease 3) (Sentrin/SUMO-specific protease SENP3) | EBI-5283823 | 0.44 |
| Q08999 | Retinoblastoma-like protein 2 (130 kDa retinoblastoma-associated protein) (p130) (Retinoblastoma-related protein 2) (RBR-2) (pRb2) | EBI-5283583 | 0.44 |
| Q9H4Z2 | Zinc finger protein 335 (NRC-interacting factor 1) (NIF-1) | EBI-5284063 | 0.44 |
| Q6UB98 | Ankyrin repeat domain-containing protein 12 (Ankyrin repeat-containing cofactor 2) (GAC-1 protein) | EBI-5283727 | 0.44 |
| Q9C0J8 | pre-mRNA 3' end processing protein WDR33 (WD repeat-containing protein 33) (WD repeat-containing protein of 146 kDa) | EBI-5282970 | 0.44 |
| P08151 | Zinc finger protein GLI1 (Glioma-associated oncogene) (Oncogene GLI) | EBI-5282953 | 0.44 |
| Q96PU4 | E3 ubiquitin-protein ligase UHRF2 (EC 2.3.2.27) (Np95/ICBP90-like RING finger protein) (Np95-like RING finger protein) (Nuclear protein 97) (Nuclear zinc finger protein Np97) (RING finger protein 107) (RING-type E3 ubiquitin transferase UHRF2) (Ubiquitin-like PHD and RING finger domain-containing protein 2) (Ubiquitin-like-containing PHD and RING finger domains protein 2) | EBI-6051398 | 0.40 |
| Q02556 | Interferon regulatory factor 8 (IRF-8) (Interferon consensus sequence-binding protein) (H-ICSBP) (ICSBP) | EBI-6115692 | 0.35 |
| P08238 | Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84) | EBI-6255377 | 0.78 |
| P07900 | Heat shock protein HSP 90-alpha (EC 3.6.4.10) (Heat shock 86 kDa) (HSP 86) (HSP86) (Lipopolysaccharide-associated protein 2) (LAP-2) (LPS-associated protein 2) (Renal carcinoma antigen NY-REN-38) | EBI-6255377 | 0.53 |
| Q00534 | Cyclin-dependent kinase 6 (EC 2.7.11.22) (Cell division protein kinase 6) (Serine/threonine-protein kinase PLSTIRE) | EBI-6255377 | 0.35 |
| Q12931 | Heat shock protein 75 kDa, mitochondrial (HSP 75) (TNFR-associated protein 1) (Tumor necrosis factor type 1 receptor-associated protein) (TRAP-1) | EBI-6255377 | 0.35 |
| Q14004 | Cyclin-dependent kinase 13 (EC 2.7.11.22) (EC 2.7.11.23) (CDC2-related protein kinase 5) (Cell division cycle 2-like protein kinase 5) (Cell division protein kinase 13) (hCDK13) (Cholinesterase-related cell division controller) | EBI-6380178 | 0.53 |
| Q13616 | Cullin-1 (CUL-1) | EBI-21323857 | 0.35 |
| Q13620 | Cullin-4B (CUL-4B) | EBI-21327757 | 0.35 |
| Q13618 | Cullin-3 (CUL-3) | EBI-21329068 | 0.35 |
| P84022 | Mothers against decapentaplegic homolog 3 (MAD homolog 3) (Mad3) (Mothers against DPP homolog 3) (hMAD-3) (JV15-2) (SMAD family member 3) (SMAD 3) (Smad3) (hSMAD3) | EBI-6593176 | 0.27 |
| Q77Q36 | viral cyclin homolog (v-cyclin) | EBI-9082540 | 0.40 |
| Q13451 | Peptidyl-prolyl cis-trans isomerase FKBP5 (PPIase FKBP5) (EC 5.2.1.8) (51 kDa FK506-binding protein) (51 kDa FKBP) (FKBP-51) (54 kDa progesterone receptor-associated immunophilin) (Androgen-regulated protein 6) (FF1 antigen) (FK506-binding protein 5) (FKBP-5) (FKBP54) (p54) (HSP90-binding immunophilin) (Rotamase) | EBI-9393873 | 0.64 |
| Q9UJC3 | Protein Hook homolog 1 (h-hook1) (hHK1) | EBI-10197685 | 0.86 |
| P03129 | Protein E7 | EBI-11721568 | 0.35 |
| Q9BX66 | Sorbin and SH3 domain-containing protein 1 (Ponsin) (SH3 domain protein 5) (SH3P12) (c-Cbl-associated protein) (CAP) | EBI-11132267 | 0.35 |
| P53814 | Smoothelin | EBI-11132267 | 0.35 |
| Q9P2E3 | NFX1-type zinc finger-containing protein 1 | EBI-11132267 | 0.35 |
| Q6PJT7 | Zinc finger CCCH domain-containing protein 14 (Mammalian suppressor of tau pathology-2) (MSUT-2) (Renal carcinoma antigen NY-REN-37) | EBI-11132267 | 0.35 |
| Q9H061 | Transmembrane protein 126A | EBI-11132267 | 0.35 |
| P46940 | Ras GTPase-activating-like protein IQGAP1 (p195) | EBI-11132927 | 0.35 |
| Q66GS9 | Centrosomal protein of 135 kDa (Cep135) (Centrosomal protein 4) | EBI-11386281 | 0.27 |
| Q8N448 | Ligand of Numb protein X 2 (Numb-binding protein 2) (PDZ domain-containing RING finger protein 1) | EBI-11766518 | 0.49 |
| Q16254 | Transcription factor E2F4 (E2F-4) | EBI-12449950 | 0.53 |
| P49815 | Tuberin (Tuberous sclerosis 2 protein) | EBI-11687060 | 0.40 |
| Q9UKT9 | Zinc finger protein Aiolos (Ikaros family zinc finger protein 3) | EBI-24394070 | 0.56 |
| Q0VD86 | Protein INCA1 (Inhibitor of CDK interacting with cyclin A1) | EBI-24622275 | 0.56 |
| Q9ULD0 | 2-oxoglutarate dehydrogenase-like, mitochondrial (EC 1.2.4.2) (2-oxoglutarate dehydrogenase complex component E1-like) (OGDC-E1-like) (Alpha-ketoglutarate dehydrogenase-like) | EBI-24764997 | 0.56 |
| Q8WXX5 | DnaJ homolog subfamily C member 9 (HDJC9) (DnaJ protein SB73) | EBI-11925475 | 0.00 |
| Q8IVT5 | Kinase suppressor of Ras 1 (EC 2.7.11.1) | EBI-14035152 | 0.35 |
| P04004 | Vitronectin (VN) (S-protein) (Serum-spreading factor) (V75) [Cleaved into: Vitronectin V65 subunit; Vitronectin V10 subunit; Somatomedin-B] | EBI-21709311 | 0.35 |
| Q9UKA8 | Calcipressin-3 (Down syndrome candidate region 1-like protein 2) (Myocyte-enriched calcineurin-interacting protein 3) (MCIP3) (Regulator of calcineurin 3) | EBI-21786597 | 0.35 |
| Q58FG0 | Putative heat shock protein HSP 90-alpha A5 (Heat shock protein 90-alpha E) (Heat shock protein 90Ae) | EBI-21835664 | 0.35 |
| Q5TC84 | Opioid growth factor receptor-like protein 1 | EBI-21835664 | 0.35 |
| Q58FF7 | Putative heat shock protein HSP 90-beta-3 (Heat shock protein 90-beta c) (Heat shock protein 90Bc) | EBI-21835664 | 0.35 |
| Q58FF6 | Putative heat shock protein HSP 90-beta 4 | EBI-21835664 | 0.35 |
| P55789 | FAD-linked sulfhydryl oxidase ALR (EC 1.8.3.2) (Augmenter of liver regeneration) (hERV1) (Hepatopoietin) | EBI-21835664 | 0.35 |
| P52333 | Tyrosine-protein kinase JAK3 (EC 2.7.10.2) (Janus kinase 3) (JAK-3) (Leukocyte janus kinase) (L-JAK) | EBI-21835664 | 0.35 |
| P08236 | Beta-glucuronidase (EC 3.2.1.31) (Beta-G1) | EBI-21835664 | 0.35 |
| Q9NZT2 | Opioid growth factor receptor (OGFr) (Protein 7-60) (Zeta-type opioid receptor) | EBI-21848776 | 0.40 |
| P46414 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | EBI-15763467 | 0.40 |
| Q92830 | Histone acetyltransferase KAT2A (EC 2.3.1.48) (General control of amino acid synthesis protein 5-like 2) (Histone acetyltransferase GCN5) (hGCN5) (Histone glutaryltransferase KAT2A) (EC 2.3.1.-) (Histone succinyltransferase KAT2A) (EC 2.3.1.-) (Lysine acetyltransferase 2A) (STAF97) | EBI-16107564 | 0.40 |
| Q9JHD2 | Histone acetyltransferase KAT2A (EC 2.3.1.48) (General control of amino acid synthesis protein 5-like 2) (Histone acetyltransferase GCN5) (MmGCN5) (Histone glutaryltransferase KAT2A) (EC 2.3.1.-) (Histone succinyltransferase KAT2A) (EC 2.3.1.-) (Lysine acetyltransferase 2A) | EBI-16107581 | 0.40 |
| Q9Y6K9 | NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier) | EBI-20737021 | 0.35 |
| Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin) | EBI-21360986 | 0.35 |
| Q9UH17 | DNA dC->dU-editing enzyme APOBEC-3B (A3B) (EC 3.5.4.38) (Phorbolin-1-related protein) (Phorbolin-2/3) | EBI-25296426 | 0.64 |
| P82930 | 28S ribosomal protein S34, mitochondrial (MRP-S34) (S34mt) (Mitochondrial small ribosomal subunit protein mS34) | EBI-25477405 | 0.35 |
| P53007 | Tricarboxylate transport protein, mitochondrial (Citrate transport protein) (CTP) (Mitochondrial citrate carrier) (CIC) (Solute carrier family 25 member 1) (Tricarboxylate carrier protein) | EBI-25477405 | 0.35 |
| P43307 | Translocon-associated protein subunit alpha (TRAP-alpha) (Signal sequence receptor subunit alpha) (SSR-alpha) | EBI-25477405 | 0.35 |
| P28482 | Mitogen-activated protein kinase 1 (MAP kinase 1) (MAPK 1) (EC 2.7.11.24) (ERT1) (Extracellular signal-regulated kinase 2) (ERK-2) (MAP kinase isoform p42) (p42-MAPK) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2) | EBI-25477405 | 0.35 |
| P54819 | Adenylate kinase 2, mitochondrial (AK 2) (EC 2.7.4.3) (ATP-AMP transphosphorylase 2) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) [Cleaved into: Adenylate kinase 2, mitochondrial, N-terminally processed] | EBI-25477405 | 0.35 |
| Q8TB24 | Ras and Rab interactor 3 (Ras interaction/interference protein 3) | EBI-26518569 | 0.35 |
| Q9H9E1 | Ankyrin repeat family A protein 2 (RFXANK-like protein 2) | EBI-26656693 | 0.35 |
| P01116 | GTPase KRas (EC 3.6.5.2) (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed] | EBI-27041844 | 0.27 |
| P01111 | GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras) | EBI-27042293 | 0.27 |
| P09936 | Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCH-L1) (EC 3.4.19.12) (Neuron cytoplasmic protein 9.5) (PGP 9.5) (PGP9.5) (Ubiquitin thioesterase L1) | EBI-27121923 | 0.59 |
| P00441 | Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) (Superoxide dismutase 1) (hSod1) | EBI-28996885 | 0.40 |
| Q13619 | Cullin-4A (CUL-4A) | EBI-30863570 | 0.35 |
Database | Links |
| UNIPROT | P11802 B2R9A0 B4DNF9 O00576 Q6FG61 |
| PDB | 2W96 2W99 2W9F 2W9Z 3G33 5FWK 5FWL 5FWM 5FWP 6P8E 6P8F 6P8G 6P8H |
| Pfam | PF00069 |
| PROSITE | PS00107 PS50011 PS00108 |
| OMIM | 123829 609048 |
| DisGeNET | 1019 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory