NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Solute carrier family 2, facilitated glucose transporter member 4 - Homo sapiens - NucEnvDB

Solute carrier family 2, facilitated glucose transporter member 4 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Solute carrier family 2, facilitated glucose transporter member 4
Accession Code	P14672
Gene	SLC2A4
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 509)
MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAVLGGSLMGLAN AAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPARKSLKRLTGWADVSGVLAEL KDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVALLLLERVPAMSYVSIVAIFG FVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND

Subcellular Location

Description
Cell membrane {By SimilarityUniProtKB:P14142}; Multi-pass membrane protein {By SimilarityUniProtKB:P14142}. Endomembrane system {ECO:0000269\|PubMed:8300557}; Multi-pass membrane protein {ECO:0000269\|PubMed:8300557}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:P14142}. Note=Localizes primarily to the perinuclear region, undergoing continued recycling to the plasma membrane where it is rapidly reinternalized (PubMed:8300557). The dileucine internalization motif is critical for intracellular sequestration (PubMed:8300557). Insulin stimulation induces translocation to the cell membrane (By similarity). {By SimilarityUniProtKB:P14142, ECO:0000269\|PubMed:8300557}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Clathrin-Coated Pit (GO:0005905) Clathrin-Coated Vesicle (GO:0030136) Cytoplasmic Vesicle Membrane (GO:0030659) Cytosol (GO:0005829) Endomembrane System (GO:0012505) External Side Of Plasma Membrane (GO:0009897) Extracellular Exosome (GO:0070062) Insulin-Responsive Compartment (GO:0032593) Membrane (GO:0016020) Membrane Raft (GO:0045121) Multivesicular Body (GO:0005771) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Presynapse (GO:0098793) Sarcolemma (GO:0042383) Sarcoplasmic Reticulum (GO:0016529) T-Tubule (GO:0030315) Trans-Golgi Network (GO:0005802) Trans-Golgi Network Transport Vesicle (GO:0030140) Vesicle Membrane (GO:0012506)

Biology & Function

Description
Insulin-regulated facilitative glucose transporter, which plays a key role in removal of glucose from circulation. Response to insulin is regulated by its intracellular localization: in the absence of insulin, it is efficiently retained intracellularly within storage compartments in muscle and fat cells. Upon insulin stimulation, translocates from these compartments to the cell surface where it transports glucose from the extracellular milieu into the cell. {By SimilarityUniProtKB:P19357}.
Assigned Ontology terms

Biological Process	Amylopectin Biosynthetic Process (GO:0010021) Brown Fat Cell Differentiation (GO:0050873) Carbohydrate Metabolic Process (GO:0005975) Cellular Response To Hypoxia (GO:0071456) Cellular Response To Insulin Stimulus (GO:0032869) Cellular Response To Osmotic Stress (GO:0071470) Cellular Response To Tumor Necrosis Factor (GO:0071356) Glucose Homeostasis (GO:0042593) Glucose Import (GO:0046323) Glucose Import In Response To Insulin Stimulus (GO:0044381) Glucose Transmembrane Transport (GO:1904659) Learning Or Memory (GO:0007611) Long-Term Memory (GO:0007616) Monosaccharide Transmembrane Transport (GO:0015749) Positive Regulation Of Brain-Derived Neurotrophic Factor Receptor Signaling Pathway (GO:0031550) Regulation Of Synaptic Vesicle Budding From Presynaptic Endocytic Zone Membrane (GO:0098694) Response To Ethanol (GO:0045471) Short-Term Memory (GO:0007614) Transport Across Blood-Brain Barrier (GO:0150104)
Molecular Function	D-Glucose Transmembrane Transporter Activity (GO:0055056) Glucose Transmembrane Transporter Activity (GO:0005355) Glucose Uniporter Activity (GO:0015304) Hexose Transmembrane Transporter Activity (GO:0015149)

Disease associations

Description
Diabetes mellitus, non-insulin-dependent (NIDDM) [MIM:125853]: A multifactorial disorder of glucose homeostasis caused by a lack of sensitivity to the body's own insulin. Affected individuals usually have an obese body habitus and manifestations of a metabolic syndrome characterized by diabetes, insulin resistance, hypertension and hypertriglyceridemia. The disease results in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. {Experimental EvidencePubMed:1521731, Experimental EvidencePubMed:1756912, Experimental EvidencePubMed:1918382}. Note=The disease may be caused by variants affecting the gene represented in this entry.
Database Associations
OMIM	125853 138190
DisGeNET	6517

Protein-Protein Interactions

Interactions with other proteins (5 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9UER7	Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein)	EBI-367160	0.63
P03410	Protein Tax-2 (Trans-activating transcriptional regulatory protein of HTLV-2)	EBI-9676334	0.49
O43889	Cyclic AMP-responsive element-binding protein 3 (CREB-3) (cAMP-responsive element-binding protein 3) (Leucine zipper protein) (Luman) (Transcription factor LZIP-alpha) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3 (N-terminal Luman) (Transcriptionally active form)]	EBI-12701388	0.56
Q9UKB3	DnaJ homolog subfamily C member 12 (J domain-containing protein 1)	EBI-21896803	0.35
Q8WU79	Stromal membrane-associated protein 2 (Stromal membrane-associated protein 1-like)	EBI-21896803	0.35

Cross-References

Database	Links
UNIPROT	P14672 Q05BQ3 Q14CX2
Pfam	PF00083
PROSITE	PS50850 PS00216 PS00217
OMIM	125853 138190
DisGeNET	6517

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK