Protein MAK11 - Saccharomyces cerevisiae S288C

Protein MAK11 (Saccharomyces cerevisiae S288C)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Protein MAK11
Accession Code	P20484
Gene	MAK11
Organism	Saccharomyces cerevisiae S288C (Taxonomy: 559292)
Part of Reference Proteome?	Yes
Sequence (Length: 414)
MSAIGDKNQFRIIVGSYEHNILCLSLDIPNQKENDAAKTPHFMPIFHFQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPASSSEDAAVSKGSKNSKWLLSASEDHK IMVWRVKDWETVGTLKGHTARVNDVDIHPTNRIAISVSDDHSIRLWNLMTLRNAAVLKLRKYNTNGTCVRWLGAKGDYFAVGLRDRVLIYETGSAKVFKEIVFQRKTLMHIETHILPFDNKEYLSVGISD GNVHFYPCEELFEKVEENEKQEDDDDKEDISPAFSLLGHTNRIKDFKFYTNEFGTYLVTIGSDGKIVVWDMSTKEQVAVYDCGERLNCLTLCDESIEKYNTMKKRDAETADIGDQSEVESDTEELKKIMF GEKKKLNKKKRKQLKKSKVSVELE

Subcellular Location

Description
Nucleus, nucleolus {Experimental EvidencePubMed:2826479}. Nucleus membrane {Experimental EvidencePubMed:2826479}; Peripheral membrane protein {Experimental EvidencePubMed:2826479}. Note=Membrane associated.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Experimental Evidence {ECO:0000269\|PubMed:2826479}
Assigned Ontology terms

Cellular Component	Membrane (GO:0016020) Nuclear Membrane (GO:0031965) Nucleolus (GO:0005730)

Biology & Function

Description
Essential for cell growth. Plays a role in assembly of 60S pre-ribosomal particles in the nucleolus. Also required for replication of the M1 double-stranded RNA of the L-A virus. This latter function may reflect an enhanced requirement for free 60S ribosomal particles for the translation of viral mRNAs which lack poly-A tails. {Experimental EvidencePubMed:12808088, Experimental EvidencePubMed:2826479, Experimental EvidencePubMed:7739558}.
Assigned Ontology terms

Biological Process	Maturation Of 5.8S RRNA From Tricistronic RRNA Transcript (SSU-RRNA, 5.8S RRNA, LSU-RRNA) (GO:0000466) Maturation Of LSU-RRNA From Tricistronic RRNA Transcript (SSU-RRNA, 5.8S RRNA, LSU-RRNA) (GO:0000463) Ribosomal Large Subunit Assembly (GO:0000027) Ribosomal Large Subunit Biogenesis (GO:0042273)
Molecular Function

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P30822	Exportin-1	EBI-11611503	0.35
P22147	5'-3' exoribonuclease 1	EBI-16273123	0.35
Interactions with other proteins (18 interactors)

Partner (UniProt)		IntAct	Confidence score
P53136	Ribosome biogenesis protein NSA1 (NOP7-associated protein 1)	EBI-801364	0.35
Q12024	Ribosome biogenesis protein YTM1 (Microtubule-associated protein YTM1)	EBI-801364	0.35
P02994	Elongation factor 1-alpha (EF-1-alpha) (Eukaryotic elongation factor 1A) (eEF1A) (Translation elongation factor 1A)	EBI-801364	0.53
Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	EBI-801364	0.35
P49626	60S ribosomal protein L4-B (L2) (Large ribosomal subunit protein uL4-B) (RP2) (YL2)	EBI-801364	0.35
Q03532	ATP-dependent RNA helicase HAS1 (EC 3.6.4.13) (Helicase associated with SET1 protein 1)	EBI-801364	0.35
P39014	F-box protein MET30 (E3 ubiquitin ligase complex SCF(Met30) subunit MET30) (Methionine-requiring protein 30)	EBI-859327	0.00
Q12329	Heat shock protein 42 (42 kDa heat shock protein)	EBI-3829080	0.35
P10591	Heat shock protein SSA1 (Heat shock protein YG100)	EBI-6556984	0.35
Q06511	Ribosomal RNA-processing protein 15	EBI-10706275	0.57
P0CX43	60S ribosomal protein L1-A (L10a) (Large ribosomal subunit protein uL1-A)	EBI-10916915	0.35
Q07915	Ribosome biogenesis protein RLP24 (Ribosomal protein L24-like)	EBI-10916915	0.35
P36160	Ribosome biogenesis protein RPF2	EBI-10918966	0.35
P53261	Pescadillo homolog (Nucleolar protein 7) (Ribosomal RNA-processing protein 13)	EBI-16273123	0.35
Q12522	Eukaryotic translation initiation factor 6 (eIF-6)	EBI-16273123	0.35
P40991	25S rRNA (cytosine(2870)-C(5))-methyltransferase (EC 2.1.1.310) (Nucleolar protein 2)	EBI-16273123	0.35
P53119	E3 ubiquitin-protein ligase HUL5 (EC 2.3.2.26)	EBI-16273123	0.35
Q04660	Ribosome biogenesis protein ERB1 (Eukaryotic ribosome biogenesis protein 1)	EBI-16273123	0.35

Cross-References

Database	Links
UNIPROT	P20484 D6VXR4
Pfam	PF00400
PROSITE	PS00678 PS50082 PS50294

Protein MAK11 (Saccharomyces cerevisiae S288C)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Interactions with other proteins (18 interactors)

Cross-References

Database

Links

Description

Description