NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Annexin A11 - Bos taurus - NucEnvDB

Annexin A11 (Bos taurus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Annexin A11
Accession Code	P27214
Gene	ANXA11
Organism	Bos taurus \| Cattle (Taxonomy: 9913)
Part of Reference Proteome?	Yes
Sequence (Length: 503)
MSYPGYPPPAGGYPPGAPGGGAWGGAGYPPPTMPPIGLDNVANYAGQFNQDYLSGVAANMSGTFGGANVPNLYPGAPGGGYPPVPPGGFGQPPPAQQPVPSYGMYPPPGGNPTSGMPSYPPYPGAPVPGQ PMLPPGQQPPGVYPGQPPMTYPGQSPVPPPGQQPVPSYPGYSGSGTVTPAVSPAQFGNRGTITDASGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNF EKTILALMKTPVLFDAYEIKEAIKGAGTDEACLIEILASRSNEHIRELNRVYKTEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMTLVQRDVQELYAAGENRLGTDESKFNAILCSRSRAHLV AVFNEYQRMTGRDIEKSICREMSGDLEQGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSEIDLLDIRAEYKRLYGKSLYHDITGDTSGDYRKILLKICGGND

Subcellular Location

Description
Cytoplasm {By Similarity}. Melanosome {By Similarity}. Nucleus envelope {By Similarity}. Nucleus, nucleoplasm {By Similarity}. Cytoplasm, cytoskeleton, spindle {By Similarity}. Note=Found throughout the nucleoplasm at interphase and during mitosis concentrates around the mitotic apparatus. Elevation of intracellular calcium causes relocalization from the nucleoplasm to the nuclear envelope, with little effect on the cytoplasmic pool. Localization to the nuclear envelope is cell-cycle dependent. {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Melanosome (GO:0042470) Membrane (GO:0016020) Midbody (GO:0030496) Nuclear Envelope (GO:0005635) Nucleoplasm (GO:0005654) Spindle (GO:0005819)

Biology & Function

Description
Binds specifically to calcyclin in a calcium-dependent manner. Required for midbody formation and completion of the terminal phase of cytokinesis. {By Similarity}.
Assigned Ontology terms

Biological Process	Cytokinetic Process (GO:0032506) Phagocytosis (GO:0006909)
Molecular Function	Calcium Ion Binding (GO:0005509) Calcium-Dependent Phospholipid Binding (GO:0005544) S100 Protein Binding (GO:0044548)

Cross-References

Database	Links
UNIPROT	P27214 P27215 Q0VD55
Pfam	PF00191
PROSITE	PS00223 PS51897

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK